StarFunc result for job id P35638

User Input

>input (169 residues)
MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASL
AWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRM
KEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P35638	1.000	1.000	9.901E-23	169	1.000	1.000	P35638.pdb.gz	DDIT3_HUMAN DNA damage-inducible transcript 3 protein OS=Homo sapiens OX=9606 GN=DDIT3 PE=1 SV=1
2	AFDB:Q22717	0.116	0.116	5.984E-1	170	0.112	0.112	Q22717.pdb.gz	HLH3_CAEEL Helix-loop-helix protein 3 OS=Caenorhabditis elegans OX=6239 GN=hlh-3 PE=1 SV=2
3	AFDB:P21520	0.261	0.067	7.438E-1	799	0.166	0.035	P21520.pdb.gz	SCA_DROME Protein scabrous OS=Drosophila melanogaster OX=7227 GN=sca PE=2 SV=3
4	AFDB:B2KUA9	0.168	0.088	7.997E-1	360	0.166	0.078	B2KUA9.pdb.gz	B2KUA9_DANRE Transcriptional regulator OS=Danio rerio OX=7955 GN=id:ibd5144 PE=2 SV=1
5	AFDB:Q9LSC7	0.154	0.101	7.997E-1	296	0.071	0.041	Q9LSC7.pdb.gz	Q9LSC7_ARATH AT3g27090/MOJ10_18 OS=Arabidopsis thaliana OX=3702 GN=At3g27090 PE=1 SV=1
6	AFDB:Q94526	0.144	0.035	9.939E-1	1001	0.142	0.024	Q94526.pdb.gz	ORK1_DROME Open rectifier potassium channel protein 1 OS=Drosophila melanogaster OX=7227 GN=Ork1 PE=1 SV=2
7	AFDB:F4IQH8	0.182	0.092	1.149	364	0.118	0.055	F4IQH8.pdb.gz	F4IQH8_ARATH Basic helix-loop-helix (BHLH) DNA-binding superfamily protein OS=Arabidopsis thaliana OX=3702 GN=HBI1 PE=1 SV=1
8	AFDB:A2R6G8	0.221	0.189	1.235	221	0.166	0.127	A2R6G8.pdb.gz	OTAR1_ASPNC Transcription factor otaR1 OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=otaR1 PE=2 SV=1
9	AFDB:O06874	0.237	0.136	1.235	315	0.178	0.095	O06874.pdb.gz	O06874_VIBAL Flagellar motor protein PomB OS=Vibrio alginolyticus OX=663 GN=pomB PE=1 SV=1
10	AFDB:B8ZZA1	0.162	0.196	1.535	131	0.124	0.160	B8ZZA1.pdb.gz	B8ZZA1_HUMAN Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA PE=1 SV=1
11	PDB:7kzfF	0.074	0.045	3.670	483	0.083	0.029	7kzfF.pdb.gz
12	PDB:6msjB	0.161	0.077	4.562	411	0.047	0.019	6msjB.pdb.gz	Cryo-EM structures and dynamics of substrate-engaged human 26S proteasome.
13	PDB:6hivAU	0.100	0.097	7.047	175	0.071	0.069	6hivAU.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
14	PDB:7mq8SB	0.132	0.052	8.146	440	0.059	0.023	7mq8SB.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:6sgaF7	0.137	0.040	8.758	662	0.083	0.021	6sgaF7.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P35638	2.92e-120	338	169	1.000	1.000	DDIT3_HUMAN DNA damage-inducible transcript 3 protein OS=Homo sapiens OX=9606 GN=DDIT3 PE=1 SV=1
2	Q62857	3.59e-104	297	168	0.899	0.905	DDIT3_RAT DNA damage-inducible transcript 3 protein OS=Rattus norvegicus OX=10116 GN=Ddit3 PE=2 SV=1
3	P35639	2.74e-98	282	168	0.882	0.887	DDIT3_MOUSE DNA damage-inducible transcript 3 protein OS=Mus musculus OX=10090 GN=Ddit3 PE=1 SV=1
4	P14607	1.19e-87	255	168	0.828	0.833	DDIT3_CRIGR DNA damage-inducible transcript 3 protein OS=Cricetulus griseus OX=10029 GN=DDIT3 PE=2 SV=1
5	F1Q964	6.28e-10	58.2	242	0.183	0.128	F1Q964_DANRE DNA damage-inducible transcript 3 protein OS=Danio rerio OX=7955 GN=zgc:162630 PE=3 SV=1
6	A3KNX2	1.65e-09	56.6	205	0.183	0.151	A3KNX2_DANRE DNA damage-inducible transcript 3 protein OS=Danio rerio OX=7955 GN=zgc:162630 PE=2 SV=1
7	Q90ZW4	6.98e-04	40.4	169	0.124	0.124	Q90ZW4_DANRE CCAAT/enhancer binding protein (C/EBP) 1 OS=Danio rerio OX=7955 GN=c/ebp1 PE=2 SV=1
8	A5X2V8	8.05e-04	40.8	320	0.112	0.059	A5X2V8_ONCMY CCAAT/enhancer-binding protein OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
9	Q7ZU07	0.001	40.0	280	0.130	0.079	Q7ZU07_DANRE CCAAT/enhancer-binding protein OS=Danio rerio OX=7955 GN=wu:fe11e05 PE=2 SV=1
10	Q00322	0.002	39.7	268	0.107	0.067	CEBPD_MOUSE CCAAT/enhancer-binding protein delta OS=Mus musculus OX=10090 GN=Cebpd PE=1 SV=2
11	Q03484	0.002	39.7	268	0.107	0.067	CEBPD_RAT CCAAT/enhancer-binding protein delta OS=Rattus norvegicus OX=10116 GN=Cebpd PE=2 SV=1
12	A5X2V9	0.003	39.3	294	0.130	0.075	A5X2V9_ONCMY CCAAT/enhancer-binding protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00073775001 PE=2 SV=1
13	P49716	0.003	39.3	269	0.107	0.067	CEBPD_HUMAN CCAAT/enhancer-binding protein delta OS=Homo sapiens OX=9606 GN=CEBPD PE=1 SV=2
14	Q8UVZ1	0.003	39.3	288	0.107	0.062	Q8UVZ1_DANRE CCAAT/enhancer-binding protein OS=Danio rerio OX=7955 GN=c/ebpa PE=2 SV=1
15	Q90582	0.005	38.5	324	0.107	0.056	Q90582_CHICK CCAAT/enhancer-binding protein OS=Gallus gallus OX=9031 GN=cC PE=3 SV=1
16	P26801	0.006	37.7	150	0.118	0.133	CEBPG_RAT CCAAT/enhancer-binding protein gamma OS=Rattus norvegicus OX=10116 GN=Cebpg PE=1 SV=2
17	P53567	0.006	37.7	150	0.118	0.133	CEBPG_HUMAN CCAAT/enhancer-binding protein gamma OS=Homo sapiens OX=9606 GN=CEBPG PE=1 SV=1
18	P49715	0.008	38.1	358	0.107	0.050	CEBPA_HUMAN CCAAT/enhancer-binding protein alpha OS=Homo sapiens OX=9606 GN=CEBPA PE=1 SV=3
19	Q7SZH5	0.008	38.1	291	0.118	0.069	Q7SZH5_ONCMY CCAAT/enhancer-binding protein OS=Oncorhynchus mykiss OX=8022 GN=C/EBPbeta PE=2 SV=1
20	P05554	0.009	37.7	358	0.095	0.045	CEBPA_RAT CCAAT/enhancer-binding protein alpha OS=Rattus norvegicus OX=10116 GN=Cebpa PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16214 AC_N	2.9e+02	12.0	Adenylyl cyclase N-terminal extracellular and transmembrane region
2	PF00170 bZIP_1	2.8	19.4	bZIP transcription factor
3	PF07716 bZIP_2	0.24	22.8	Basic region leucine zipper
4	PF03131 bZIP_Maf	3.4e+02	13.2	bZIP Maf transcription factor
5	PF16526 CLZ	1.9e+02	13.9	C-terminal leucine zipper domain of cyclic nucleotide-gated channels
6	PF08287 DASH_Spc19	1.6e+02	13.6	Spc19
7	PF04977 DivIC	42	15.3	Septum formation initiator
8	PF18077 DUF5595	1.6e+02	13.8	Domain of unknown function (DUF5595)
9	PF12709 Fungal_TACC	1.7e+02	14.1	Fungal Transforming acidic coiled-coil (TACC) proteins
10	PF13851 GAS	4.3	18.2	Growth-arrest specific micro-tubule binding
11	PF14303 NAM-associated	5.9e+02	12.6	No apical meristem-associated C-terminal domain
12	PF02932 Neur_chan_memb	7.9e+02	11.5	Neurotransmitter-gated ion-channel transmembrane region
13	PF06459 RR_TM4-6	6.3e+02	11.6	Ryanodine Receptor TM 4-6

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000448665

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000305422	0.997	CCAAT/enhancer-binding protein beta
2	9606.ENSP00000336790	0.995	Cyclic AMP-dependent transcription factor ATF-4
3	9606.ENSP00000344352	0.991	Cyclic AMP-dependent transcription factor ATF-3
4	9606.ENSP00000217233	0.990	Tribbles homolog 3
5	9606.ENSP00000356919	0.989	Cyclic AMP-dependent transcription factor ATF-6 alpha
6	9606.ENSP00000256383	0.979	Eukaryotic translation initiation factor 2 subunit 1
7	9606.ENSP00000216037	0.976	X-box-binding protein 1
8	9606.ENSP00000284000	0.967	CCAAT/enhancer-binding protein gamma
9	9606.ENSP00000376943	0.960	Bcl-2-like protein 11
10	9606.ENSP00000229795	0.952	Mitogen-activated protein kinase 14
11	9606.ENSP00000404503	0.948	Bcl-2-binding component 3
12	9606.ENSP00000324173	0.936	78 kDa glucose-regulated protein
13	9606.ENSP00000360266	0.935	Transcription factor AP-1
14	9606.ENSP00000306245	0.931	Proto-oncogene c-Fos
15	9606.ENSP00000427514	0.931	CCAAT/enhancer-binding protein alpha
16	9606.ENSP00000380252	0.920	Nuclear factor erythroid 2-related factor 2
17	9606.ENSP00000333685	0.918	Mitogen-activated protein kinase 11
18	9606.ENSP00000364119	0.911	Eukaryotic translation initiation factor 2 subunit 2
19	9606.ENSP00000345702	0.906	Nuclear transcription factor Y subunit alpha
20	9606.ENSP00000253039	0.905	Eukaryotic translation initiation factor 2 subunit 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0046982	1.000	protein heterodimerization activity
GO:0061629	1.000	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0019904	0.996	protein domain specific binding
GO:0000987	0.995	cis-regulatory region sequence-specific DNA binding
GO:0030275	0.994	LRR domain binding
GO:0000981	0.992	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0042803	0.992	protein homodimerization activity
GO:0000978	0.986	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.984	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0008140	0.829	cAMP response element binding protein binding
GO:0043522	0.800	leucine zipper domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.995	regulation of cellular process
GO:1903506	0.989	regulation of nucleic acid-templated transcription
GO:0051716	0.986	cellular response to stimulus
GO:0051090	0.982	regulation of DNA-binding transcription factor activity
GO:0043065	0.980	positive regulation of apoptotic process
GO:1902679	0.977	negative regulation of RNA biosynthetic process
GO:0006984	0.976	ER-nucleus signaling pathway
GO:0034976	0.972	response to endoplasmic reticulum stress
GO:0010033	0.967	response to organic substance
GO:0044092	0.963	negative regulation of molecular function
GO:1903507	0.958	negative regulation of nucleic acid-templated transcription
GO:0009966	0.949	regulation of signal transduction
GO:0045892	0.947	negative regulation of DNA-templated transcription
GO:0043618	0.936	regulation of transcription from RNA polymerase II promoter in response to stress
GO:0045893	0.935	positive regulation of DNA-templated transcription
GO:0070887	0.928	cellular response to chemical stimulus
GO:0045944	0.927	positive regulation of transcription by RNA polymerase II
GO:0030968	0.922	endoplasmic reticulum unfolded protein response
GO:0051101	0.915	regulation of DNA binding
GO:0006915	0.895	apoptotic process
GO:0008152	0.888	metabolic process
GO:0036003	0.888	positive regulation of transcription from RNA polymerase II promoter in response to stress
GO:0071704	0.880	organic substance metabolic process
GO:0043170	0.848	macromolecule metabolic process
GO:1901214	0.841	regulation of neuron death
GO:1901216	0.814	positive regulation of neuron death
GO:0035556	0.797	intracellular signal transduction
GO:0051239	0.791	regulation of multicellular organismal process
GO:0097190	0.761	apoptotic signaling pathway
GO:0051100	0.749	negative regulation of binding
GO:0097193	0.749	intrinsic apoptotic signaling pathway
GO:0043523	0.737	regulation of neuron apoptotic process
GO:0044238	0.717	primary metabolic process
GO:0043525	0.710	positive regulation of neuron apoptotic process
GO:0070059	0.697	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress
GO:0006807	0.680	nitrogen compound metabolic process
GO:0044237	0.680	cellular metabolic process
GO:0043392	0.658	negative regulation of DNA binding
GO:0044093	0.651	positive regulation of molecular function
GO:1901564	0.605	organonitrogen compound metabolic process
GO:0048585	0.581	negative regulation of response to stimulus
GO:0048584	0.564	positive regulation of response to stimulus
GO:1902531	0.563	regulation of intracellular signal transduction
GO:0080134	0.562	regulation of response to stress
GO:0080135	0.488	regulation of cellular response to stress
GO:0019538	0.462	protein metabolic process
GO:0000122	0.456	negative regulation of transcription by RNA polymerase II
GO:0023057	0.444	negative regulation of signaling
GO:0010648	0.444	negative regulation of cell communication
GO:0009968	0.430	negative regulation of signal transduction
GO:0051091	0.368	positive regulation of DNA-binding transcription factor activity
GO:0043433	0.344	negative regulation of DNA-binding transcription factor activity
GO:0001817	0.314	regulation of cytokine production

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0005667	0.994	transcription regulator complex
GO:0005654	0.994	nucleoplasm
GO:0140513	0.991	nuclear protein-containing complex
GO:0090575	0.981	RNA polymerase II transcription regulator complex
GO:0005829	0.964	cytosol
GO:0012505	0.702	endomembrane system
GO:0036488	0.681	CHOP-C/EBP complex
GO:0032993	0.502	protein-DNA complex
GO:0031982	0.397	vesicle
GO:1990622	0.385	CHOP-ATF3 complex
GO:1990617	0.385	CHOP-ATF4 complex
GO:0016020	0.357	membrane
GO:0043232	0.304	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]