StarFunc result for job id P35658

User Input

>input (2090 residues)
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKYGLVFAGGASGLQ
IFPTKNLLIQNKPGDDPNKIVDKVQGLLVPMKFPIHHLALSCDNLTLSACMMSSEYGSII
AFFDVRTFSNEAKQQKRPFAYHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQYLPTLQEKKVIPCPPFYESDHP
VRVLDVLWIGTYVFAIVYAAADGTLETSPDVVMALLPKKEEKHPEIFVNFMEPCYGSCTE
RQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDYTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFYMINQNPGVKSLIKTPERL
SLEGERQPKSPGSTPTTPTSSQAPQKLDASAAAAPASLPPSSPAAPIATFSLLPAGGAPT
VFSFGSSSLKSSATVTGEPPSYSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSEKFTAAATSTPV
SSSQSAPPMSPFSSASKPAASGPLSHPTPLSAPPSSVPLKSSVLPSPSGRSAQGSSSPVP
SMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEEL
KARTSKACFQVGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVE
EAREQNERNRDSGYLHLLYKRPLDPKSEAQLQEIRRLHQYVKFAVQDVNDVLDLEWDQHL
EQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAV
PSQSSIHSFDSDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVR
STAPASLSRSAFLSQRYYEDLDEVSSTSSVSQSLESEDARTSCKDDEAVVQAPRHAPVVR
TPSIQPSLLPHAAPFAKSHLVHGSSPGVMGTSVATSASKIIPQGADSTMLATKTVKHGAP
SPSHPISAPQAAAAAALRRQMASQAPAVNTLTESTLKNVPQVVNVQELKNNPATPSTAMG
SSVPYSTAKTPHPVLTPVAANQAKQGSLINSLKPSGPTPASGQLSSGDKASGTAKIETAV
TSTPSASGQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGGG
SKPSYEAIPESSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGEL
LFPSSLAGETLGSFSGLRVGQADDSTKPTNKASSTSLTSTQPTKTSGVPSGFNFTAPPVL
GKHTEPPVTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSFS
FGSQQTNSTVPPSAPPPTTAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSA
LPEKPGDSEVSASAASLLEEQQSAQLPQAPPQTSDSVKKEPVLAQPAVSNSGTAASSTSL
VALSAEATPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASST
TSIVAPGPSAEAAAFGTVTSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAAS
TAPSLFGQQTGSTASTAAATPQVSSSGFSSPAFGTTAPGVFGQTTFGQASVFGQSASSAA
SVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFGQ
SNAPAFGQSPGFGQGGSVFGGTSAATTTAATSGFSFCQASGFGSSNTGSVFGQAASTGGI
VFGQQSSSSSGSVFGSGNTGRGGGFFSGLGGKPSQDAANKNPFSSASGGFGSTATSNTSN
LFGNSGAKTFGGFASSSFGEQKPTGTFSSGGGSVASQGFGFSSPNKTGGFGAAPVFGSPP
TFGGSPGFGGVPAFGSAPAFTSPLGSTGGKVFGEGTAAASAGGFGFGSSSNTTSFGTLAS
QNAPTFGSLSQQTSGFGTQSSGFSGFGSGTGGFSFGSNNSSVQGFGGWRS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P35658	0.999	0.999	0.000	2090	1.000	1.000	P35658.pdb.gz	NU214_HUMAN Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2
2	AFDB:Q80U93	0.232	0.233	0.000	2085	0.775	0.776	Q80U93.pdb.gz	NU214_MOUSE Nuclear pore complex protein Nup214 OS=Mus musculus OX=10090 GN=Nup214 PE=1 SV=2
3	AFDB:Q9W1X4	0.207	0.250	2.838E-59	1711	0.205	0.251	Q9W1X4.pdb.gz	NU214_DROME Nuclear pore complex protein Nup214 OS=Drosophila melanogaster OX=7227 GN=Nup214 PE=1 SV=2
4	AFDB:F4I1T7	0.188	0.213	3.394E-43	1819	0.184	0.212	F4I1T7.pdb.gz	NP214_ARATH Nuclear pore complex protein NUP214 OS=Arabidopsis thaliana OX=3702 GN=NUP214 PE=1 SV=1
5	AFDB:Q17602	0.189	0.279	4.310E-42	1390	0.136	0.205	Q17602.pdb.gz	NU214_CAEEL Nuclear pore complex protein 14 OS=Caenorhabditis elegans OX=6239 GN=npp-14 PE=1 SV=1
6	PDB:7r5jV0	0.039	0.239	8.136E-28	273	0.131	1.000	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
7	AFDB:P40477	0.162	0.228	5.041E-15	1460	0.098	0.140	P40477.pdb.gz	NU159_YEAST Nucleoporin NUP159 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUP159 PE=1 SV=1
8	PDB:7styA	0.136	0.625	7.522E-14	390	0.022	0.115	7styA.pdb.gz
9	PDB:8gqeA	0.142	0.735	2.537E-13	348	0.026	0.155	8gqeA.pdb.gz
10	AFDB:Q6P5H2	0.036	0.037	3.119E-11	1864	0.111	0.124	Q6P5H2.pdb.gz	NEST_MOUSE Nestin OS=Mus musculus OX=10090 GN=Nes PE=1 SV=1
11	PDB:7vggA	0.123	0.712	3.872E-11	304	0.023	0.161	7vggA.pdb.gz
12	PDB:5mzhB	0.109	0.460	4.325E-11	415	0.021	0.104	5mzhB.pdb.gz
13	PDB:6bk8M	0.116	0.631	5.701E-11	326	0.021	0.135	6bk8M.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
14	PDB:2h9lA	0.128	0.695	7.111E-11	321	0.026	0.171	2h9lA.pdb.gz
15	PDB:6tblF	0.121	0.633	7.942E-11	336	0.026	0.164	6tblF.pdb.gz
16	PDB:4bujC	0.127	0.555	1.236E-10	392	0.029	0.153	4bujC.pdb.gz
17	PDB:6kivN	0.123	0.578	1.236E-10	366	0.022	0.126	6kivN.pdb.gz	Structural basis of nucleosome recognition and modification by MLL methyltransferases.
18	AFDB:Q9VC96	0.117	0.111	2.157E-10	2232	0.137	0.128	Q9VC96.pdb.gz	Q9VC96_DROME BRWD3 OS=Drosophila melanogaster OX=7227 GN=BRWD3 PE=1 SV=2
19	AFDB:F1LRR4	0.083	0.103	4.941E-10	1551	0.084	0.113	F1LRR4.pdb.gz	F1LRR4_RAT WD repeat domain 62 OS=Rattus norvegicus OX=10116 GN=Wdr62 PE=1 SV=4
20	AFDB:Q8INR6	0.047	0.052	2.116E-8	1848	0.102	0.115	Q8INR6.pdb.gz	DOT1L_DROME Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Drosophila melanogaster OX=7227 GN=gpp PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4ACK1	0.0	2830	2068	0.778	0.786	D4ACK1_RAT Nucleoporin 214 OS=Rattus norvegicus OX=10116 GN=Nup214 PE=1 SV=3
2	P35658	0.0	4119	2090	1.000	1.000	NU214_HUMAN Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2
3	Q80U93	0.0	2813	2085	0.773	0.775	NU214_MOUSE Nuclear pore complex protein Nup214 OS=Mus musculus OX=10090 GN=Nup214 PE=1 SV=2
4	M0RBV9	5.58e-159	491	269	0.109	0.844	M0RBV9_RAT Nucleoporin 214 OS=Rattus norvegicus OX=10116 GN=Nup214 PE=1 SV=3
5	Q9W1X4	1.82e-48	194	1711	0.057	0.070	NU214_DROME Nuclear pore complex protein Nup214 OS=Drosophila melanogaster OX=7227 GN=Nup214 PE=1 SV=2
6	Q17602	1.15e-23	112	1390	0.045	0.068	NU214_CAEEL Nuclear pore complex protein 14 OS=Caenorhabditis elegans OX=6239 GN=npp-14 PE=1 SV=1
7	Q09847	8.87e-16	86.7	1325	0.053	0.083	NU146_SCHPO Nucleoporin nup146 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nup146 PE=1 SV=1
8	Q9VCH5	1.72e-14	82.4	1960	0.078	0.084	NUP98_DROME Nuclear pore complex protein Nup98-Nup96 OS=Drosophila melanogaster OX=7227 GN=Nup98-96 PE=1 SV=3
9	E7F981	4.40e-09	64.7	1814	0.045	0.052	E7F981_DANRE Nuclear pore complex protein Nup98-Nup96 OS=Danio rerio OX=7955 GN=im:7151238 PE=1 SV=3
10	F4I1T7	2.41e-08	62.0	1819	0.044	0.051	NP214_ARATH Nuclear pore complex protein NUP214 OS=Arabidopsis thaliana OX=3702 GN=NUP214 PE=1 SV=1
11	Q387F2	1.01e-07	60.1	1553	0.040	0.053	Q387F2_TRYB2 Nucleoporin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0140 PE=4 SV=1
12	Q383G9	1.18e-07	59.7	1464	0.068	0.098	Q383G9_TRYB2 Spt5 C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2885 PE=4 SV=1
13	Q6PFD9	1.35e-07	59.7	1816	0.062	0.072	NUP98_MOUSE Nuclear pore complex protein Nup98-Nup96 OS=Mus musculus OX=10090 GN=Nup98 PE=1 SV=2
14	P49793	7.78e-07	57.4	1816	0.062	0.071	NUP98_RAT Nuclear pore complex protein Nup98-Nup96 OS=Rattus norvegicus OX=10116 GN=Nup98 PE=1 SV=2
15	P52948	2.75e-06	55.5	1817	0.065	0.074	NUP98_HUMAN Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98 PE=1 SV=4
16	G5EEH9	6.15e-06	54.3	1678	0.043	0.054	NUP98_CAEEL Nuclear pore complex protein Nup98-Nup96 OS=Caenorhabditis elegans OX=6239 GN=npp-10 PE=1 SV=1
17	Q02630	2.05e-05	52.4	1113	0.065	0.122	NU116_YEAST Nucleoporin NUP116/NSP116 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUP116 PE=1 SV=2
18	Q584I6	7.01e-05	50.4	641	0.057	0.186	Q584I6_TRYB2 Nucleoporin (NUP54/57), putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3M17.740 PE=4 SV=1
19	A0A0R4IAQ8	3.49e-04	48.5	1807	0.032	0.037	A0A0R4IAQ8_DANRE Nuclear pore complex protein Nup98-Nup96 OS=Danio rerio OX=7955 GN=im:7151238 PE=1 SV=2
20	P40477	6.23e-04	47.8	1460	0.044	0.064	NU159_YEAST Nucleoporin NUP159 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUP159 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	1.3	20.7	Anaphase-promoting complex subunit 4 WD40 domain
2	PF08269 dCache_2	2.4e+02	12.3	Cache domain
3	PF16755 NUP214	60	14.3	Nucleoporin or Nuclear pore complex subunit NUP214=Nup159
4	PF18617 Nup214_FG	3e-25	99.7	Nucleoporin Nup214 phenylalanine-glycine (FG) domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000352400

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000283195	0.999	E3 SUMO-protein ligase RanBP2
2	9606.ENSP00000288071	0.999	ATP-dependent RNA helicase DDX19B
3	9606.ENSP00000308622	0.999	Nucleoporin GLE1
4	9606.ENSP00000384863	0.999	Exportin-1
5	9606.ENSP00000458954	0.999	Nuclear pore complex protein Nup88
6	9606.ENSP00000471191	0.999	Nuclear pore glycoprotein p62
7	9606.ENSP00000436679	0.996	Nuclear RNA export factor 1
8	9606.ENSP00000444029	0.994	Nuclear pore complex protein Nup153
9	9606.ENSP00000290158	0.990	Importin subunit beta-1
10	9606.ENSP00000262160	0.989	Mothers against decapentaplegic homolog 2
11	9606.ENSP00000229179	0.988	Nuclear pore complex protein Nup107
12	9606.ENSP00000379182	0.986	mRNA export factor
13	9606.ENSP00000254508	0.984	Nuclear pore membrane glycoprotein 210
14	9606.ENSP00000382779	0.983	Nucleoporin SEH1
15	9606.ENSP00000401470	0.983	Ran GTPase-activating protein 1
16	9606.ENSP00000219169	0.982	Nuclear transport factor 2
17	9606.ENSP00000231498	0.982	Nuclear pore complex protein Nup155
18	9606.ENSP00000310668	0.982	Nuclear pore complex protein Nup93
19	9606.ENSP00000345895	0.980	Nuclear pore complex protein Nup50
20	9606.ENSP00000285968	0.975	Nuclear pore complex protein Nup205

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005049	1.000	nuclear export signal receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.992	regulation of cellular process
GO:0071704	0.987	organic substance metabolic process
GO:0043170	0.977	macromolecule metabolic process
GO:0006405	0.966	RNA export from nucleus
GO:0006406	0.959	mRNA export from nucleus
GO:0008104	0.756	protein localization
GO:0006886	0.698	intracellular protein transport
GO:0060341	0.398	regulation of cellular localization
GO:0051049	0.358	regulation of transport
GO:0046822	0.337	regulation of nucleocytoplasmic transport
GO:0006611	0.315	protein export from nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005635	1.000	nuclear envelope
GO:0005654	0.999	nucleoplasm
GO:0005737	0.996	cytoplasm
GO:0032991	0.995	protein-containing complex
GO:0005829	0.993	cytosol
GO:0140513	0.958	nuclear protein-containing complex
GO:0005643	0.576	nuclear pore
GO:0016020	0.394	membrane
GO:1990876	0.368	cytoplasmic side of nuclear pore

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]