StarFunc result for job id P35659

User Input

>input (375 residues)
MSASAPAAEGEGTPTQPASEKEPEMPGPREESEEEEDEDDEEEEEEEKEKSLIVEGKREK
KKVERLTMQVSSLQREPFTIAQGKGQKLCEIERIHFFLSKKKTDELRNLHKLLYNRPGTV
SSLKKNVGQFSGFPFEKGSVQYKKKEEMLKKFRNAMLKSICEVLDLERSGVNSELVKRIL
NFLMHPKPSGKPLPKSKKTCSKGSKKERNSSGMARKAKRTKCPEILSDESSSDEDEKKNK
EESSDDEDKESEEEPPKKTAKREKPKQKATSKSKKSVKSANVKKADSSTTKKNQNSSKKE
SESEDSSDDEPLIKKLKKPPTDEELKETIKKLLASANLEEVTMKQICKKVYENYPTYDLT
ERKDFIKTTVKELIS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A494C028	0.533	0.527	2.222E-41	380	1.000	0.987	A0A494C028.pdb.gz	A0A494C028_HUMAN DEK proto-oncogene OS=Homo sapiens OX=9606 GN=DEK PE=1 SV=1
2	AFDB:Q7TNV0	0.706	0.698	9.013E-40	380	0.915	0.903	Q7TNV0.pdb.gz	DEK_MOUSE Protein DEK OS=Mus musculus OX=10090 GN=Dek PE=1 SV=1
3	AFDB:Q8T0D3	0.287	0.164	2.172E-12	669	0.349	0.196	Q8T0D3.pdb.gz	Q8T0D3_DROME Dek, isoform B OS=Drosophila melanogaster OX=7227 GN=Dek PE=1 SV=1
4	AFDB:Q9SUA1	0.328	0.172	3.511E-10	763	0.296	0.145	Q9SUA1.pdb.gz	DEKP3_ARATH DEK domain-containing chromatin-associated protein 3 OS=Arabidopsis thaliana OX=3702 GN=DEK3 PE=1 SV=1
5	AFDB:Q62414	0.079	0.079	9.382E-2	383	0.147	0.144	Q62414.pdb.gz	NDF2_MOUSE Neurogenic differentiation factor 2 OS=Mus musculus OX=10090 GN=Neurod2 PE=1 SV=3
6	AFDB:J9VNT4	0.138	0.029	1.537E-1	1931	0.085	0.017	J9VNT4.pdb.gz	CHS5_CRYNH Chitin synthase 5 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS5 PE=2 SV=1
7	AFDB:Q9VY97	0.094	0.037	1.537E-1	1425	0.104	0.027	Q9VY97.pdb.gz	Q9VY97_DROME Mutagen-sensitive 101 OS=Drosophila melanogaster OX=7227 GN=mus101 PE=1 SV=1
8	AFDB:Q8N344	0.088	0.077	2.921E-1	545	0.107	0.073	Q8N344.pdb.gz	MIER2_HUMAN Mesoderm induction early response protein 2 OS=Homo sapiens OX=9606 GN=MIER2 PE=1 SV=2
9	AFDB:F1R9I0	0.112	0.061	5.028E-1	891	0.128	0.054	F1R9I0.pdb.gz
10	AFDB:Q9VHC8	0.117	0.141	5.028E-1	308	0.099	0.120	Q9VHC8.pdb.gz	Q9VHC8_DROME LD31448p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8149 PE=1 SV=1
11	PDB:7z0oG	0.136	0.556	5.648E-1	84	0.032	0.143	7z0oG.pdb.gz	Mechanism of RNA polymerase I selection by transcription factor UAF.
12	PDB:1zbuB	0.097	0.119	1.185	304	0.024	0.030	1zbuB.pdb.gz	Structural basis for 3'-end specific recognition of histone mRNA stem-loop by 3'-exonuclease, a human nuclease that also targets siRNA
13	PDB:3jb9X	0.098	0.033	3.027	1195	0.048	0.015	3jb9X.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
14	PDB:7asvA	0.082	0.161	3.180	155	0.056	0.135	7asvA.pdb.gz
15	PDB:4c3bC	0.079	0.141	3.688	178	0.037	0.079	4c3bC.pdb.gz	Crystal Structure of the Essential Transcription Antiterminator M2-1 Protein of Human Respiratory Syncytial Virus and Implications of its Phosphorylation.
16	PDB:6r7nB	0.096	0.091	4.070	443	0.056	0.047	6r7nB.pdb.gz	Structural basis of Cullin 2 RING E3 ligase regulation by the COP9 signalosome.
17	PDB:7o37c	0.064	0.082	4.493	259	0.051	0.073	7o37c.pdb.gz	Structure and assembly of the mammalian mitochondrial supercomplex CIII 2 CIV.
18	PDB:5nr5A	0.092	0.253	4.959	113	0.045	0.150	5nr5A.pdb.gz
19	PDB:6p6cA	0.106	0.328	4.959	90	0.027	0.111	6p6cA.pdb.gz
20	PDB:2jrfA	0.094	0.165	5.474	178	0.035	0.073	2jrfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A494C028	0.0	737	380	1.000	0.987	A0A494C028_HUMAN DEK proto-oncogene OS=Homo sapiens OX=9606 GN=DEK PE=1 SV=1
2	H0Y993	0.0	731	380	0.992	0.979	H0Y993_HUMAN DEK oncogene (DNA binding), isoform CRA_b OS=Homo sapiens OX=9606 GN=DEK PE=1 SV=2
3	P35659	0.0	737	375	1.000	1.000	DEK_HUMAN Protein DEK OS=Homo sapiens OX=9606 GN=DEK PE=1 SV=1
4	Q7TNV0	1.53e-179	505	380	0.864	0.853	DEK_MOUSE Protein DEK OS=Mus musculus OX=10090 GN=Dek PE=1 SV=1
5	Q8IFW6	1.53e-21	98.6	612	0.165	0.101	Q8IFW6_DROME DEK protein OS=Drosophila melanogaster OX=7227 GN=Dek PE=1 SV=1
6	A1ZAK4	1.78e-21	98.2	663	0.165	0.094	A1ZAK4_DROME Dek, isoform A OS=Drosophila melanogaster OX=7227 GN=Dek PE=1 SV=1
7	A1ZAK3	1.79e-21	98.2	667	0.165	0.093	A1ZAK3_DROME Dek, isoform C OS=Drosophila melanogaster OX=7227 GN=Dek PE=1 SV=1
8	Q8T0D3	2.02e-21	98.2	669	0.165	0.093	Q8T0D3_DROME Dek, isoform B OS=Drosophila melanogaster OX=7227 GN=Dek PE=1 SV=1
9	O96829	3.21e-21	97.4	638	0.165	0.097	O96829_DROME EG:EG0003.6 protein OS=Drosophila melanogaster OX=7227 GN=Dek PE=4 SV=1
10	Q9SMM8	8.42e-20	92.8	462	0.301	0.245	DEKP1_ARATH DEK domain-containing chromatin-associated protein 1 OS=Arabidopsis thaliana OX=3702 GN=DEK1 PE=1 SV=1
11	Q9SUA1	8.99e-05	47.0	763	0.152	0.075	DEKP3_ARATH DEK domain-containing chromatin-associated protein 3 OS=Arabidopsis thaliana OX=3702 GN=DEK3 PE=1 SV=1
12	F4K4Y5	0.018	39.7	778	0.147	0.071	DEKP4_ARATH DEK domain-containing chromatin-associated protein 4 OS=Arabidopsis thaliana OX=3702 GN=DEK4 PE=1 SV=1
13	Q57WI5	0.060	37.4	305	0.085	0.105	Q57WI5_TRYB2 Borealin N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.28B13.190 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08766 DEK_C	6.5e-15	66.1	DEK C terminal domain
2	PF02037 SAP	0.027	25.5	SAP domain
3	PF18953 SAP_new25	35	15.4	SAP domain-containing new25

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380414

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358151	0.957	Histone H2B type 2-E
2	9606.ENSP00000332194	0.953	Histone H2A type 2-C
3	9606.ENSP00000427514	0.948	CCAAT/enhancer-binding protein alpha
4	9606.ENSP00000363668	0.946	Death domain-associated protein 6
5	9606.ENSP00000296417	0.939	Histone H2A.Z
6	9606.ENSP00000377001	0.937	Speckle-type POZ protein
7	9606.ENSP00000308405	0.931	Histone H2A.V
8	9606.ENSP00000326261	0.926	Serine/arginine repetitive matrix protein 1
9	9606.ENSP00000434024	0.925	Histone H2AX
10	9606.ENSP00000477527	0.921	Histone H2B type 1-O
11	9606.ENSP00000479169	0.921	Histone H2B type 1-H
12	9606.ENSP00000438553	0.919	Histone H2A.J
13	9606.ENSP00000367022	0.918	Histone H2A type 1-C
14	9606.ENSP00000484261	0.918	Histone H2A-Bbd type 1
15	9606.ENSP00000482674	0.917	Histone H2B type 1-B
16	9606.ENSP00000483903	0.917	Histone H2B type 1-N
17	9606.ENSP00000274764	0.916	Histone H2B type 1-A
18	9606.ENSP00000349430	0.915	Histone H2B type 1-K
19	9606.ENSP00000481622	0.915	Histone H2B type F-S
20	9606.ENSP00000328484	0.914	Histone H2A type 1-J

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042393	1.000	histone binding
GO:0003723	1.000	RNA binding
GO:0003677	0.782	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0060255	0.979	regulation of macromolecule metabolic process
GO:0009987	0.964	cellular process
GO:0080090	0.950	regulation of primary metabolic process
GO:0051171	0.950	regulation of nitrogen compound metabolic process
GO:0031323	0.945	regulation of cellular metabolic process
GO:0008152	0.905	metabolic process
GO:0071704	0.850	organic substance metabolic process
GO:0019219	0.833	regulation of nucleobase-containing compound metabolic process
GO:0043170	0.832	macromolecule metabolic process
GO:0048583	0.794	regulation of response to stimulus
GO:2001020	0.784	regulation of response to DNA damage stimulus
GO:0044238	0.773	primary metabolic process
GO:0006807	0.764	nitrogen compound metabolic process
GO:0044237	0.729	cellular metabolic process
GO:0048518	0.702	positive regulation of biological process
GO:0034641	0.665	cellular nitrogen compound metabolic process
GO:1901360	0.661	organic cyclic compound metabolic process
GO:0006725	0.655	cellular aromatic compound metabolic process
GO:0051052	0.646	regulation of DNA metabolic process
GO:0006139	0.645	nucleobase-containing compound metabolic process
GO:0090304	0.627	nucleic acid metabolic process
GO:0010468	0.615	regulation of gene expression
GO:0048522	0.614	positive regulation of cellular process
GO:0006282	0.612	regulation of DNA repair
GO:2000779	0.593	regulation of double-strand break repair
GO:0051252	0.589	regulation of RNA metabolic process
GO:0006355	0.576	regulation of DNA-templated transcription
GO:0009893	0.525	positive regulation of metabolic process
GO:0010604	0.520	positive regulation of macromolecule metabolic process
GO:0051173	0.519	positive regulation of nitrogen compound metabolic process
GO:0050896	0.510	response to stimulus
GO:0031325	0.510	positive regulation of cellular metabolic process
GO:0045935	0.401	positive regulation of nucleobase-containing compound metabolic process
GO:0016070	0.387	RNA metabolic process
GO:0010467	0.382	gene expression
GO:0010557	0.367	positive regulation of macromolecule biosynthetic process
GO:0031328	0.358	positive regulation of cellular biosynthetic process
GO:0051254	0.349	positive regulation of RNA metabolic process
GO:0051716	0.306	cellular response to stimulus
GO:0045893	0.305	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043228	0.946	non-membrane-bounded organelle
GO:0043232	0.941	intracellular non-membrane-bounded organelle
GO:0032991	0.938	protein-containing complex
GO:0005737	0.575	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]