StarFunc result for job id P35670

User Input

>input (1465 residues)
MPEQERQITAREGASRKILSKLSLPTRAWEPAMKKSFAFDNVGYEGGLDGLGPSSQVATS
TVRILGMTCQSCVKSIEDRISNLKGIISMKVSLEQGSATVKYVPSVVCLQQVCHQIGDMG
FEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSN
QEAVITYQPYLIQPEDLRDHVNDMGFEAAIKSKVAPLSLGPIDIERLQSTNPKRPLSSAN
QNFNNSETLGHQGSHVVTLQLRIDGMHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVK
YDPSCTSPVALQRAIEALPPGNFKVSLPDGAEGSGTDHRSSSSHSPGSPPRNQVQGTCST
TLIAIAGMTCASCVHSIEGMISQLEGVQQISVSLAEGTATVLYNPSVISPEELRAAIEDM
GFEASVVSESCSTNPLGNHSAGNSMVQTTDGTPTSVQEVAPHTGRLPANHAPDILAKSPQ
STRAVAPQKCFLQIKGMTCASCVSNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPL
EIAQFIQDLGFEAAVMEDYAGSDGNIELTITGMTCASCVHNIESKLTRTNGITYASVALA
TSKALVKFDPEIIGPRDIIKIIEEIGFHASLAQRNPNAHHLDHKMEIKQWKKSFLCSLVF
GIPVMALMIYMLIPSNEPHQSMVLDHNIIPGLSILNLIFFILCTFVQLLGGWYFYVQAYK
SLRHRSANMDVLIVLATSIAYVYSLVILVVAVAEKAERSPVTFFDTPPMLFVFIALGRWL
EHLAKSKTSEALAKLMSLQATEATVVTLGEDNLIIREEQVPMELVQRGDIVKVVPGGKFP
VDGKVLEGNTMADESLITGEAMPVTKKPGSTVIAGSINAHGSVLIKATHVGNDTTLAQIV
KLVEEAQMSKAPIQQLADRFSGYFVPFIIIMSTLTLVVWIVIGFIDFGVVQRYFPNPNKH
ISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHK
IKTVMFDKTGTITHGVPRVMRVLLLGDVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCK
EELGTETLGYCTDFQAVPGCGIGCKVSNVEGILAHSERPLSAPASHLNEAGSLPAEKDAV
PQTFSVLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQ
EAALAVHTLQSMGVDVVLITGDNRKTARAIATQVGINKVFAEVLPSHKVAKVQELQNKGK
KVAMVGDGVNDSPALAQADMGVAIGTGTDVAIEAADVVLIRNDLLDVVASIHLSKRTVRR
IRINLVLALIYNLVGIPIAAGVFMPIGIVLQPWMGSAAMAASSVSVVLSSLQLKCYKKPD
LERYEAQAHGHMKPLTASQVSVHIGMDDRWRDSPRATPWDQVSYVSQVSLSSLTSDKPSR
HSAAADDDGDKWSLLLNGRDEEQYI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A669KA36	0.314	0.410	0.000	1110	0.756	0.998	A0A669KA36.pdb.gz	A0A669KA36_HUMAN P-type Cu(+) transporter (Fragment) OS=Homo sapiens OX=9606 GN=ATP7B PE=1 SV=1
2	AFDB:F1Q5B3	0.582	0.569	0.000	1500	0.554	0.541	F1Q5B3.pdb.gz
3	AFDB:G5EE14	0.593	0.698	0.000	1238	0.362	0.429	G5EE14.pdb.gz	G5EE14_CAEEL P-type Cu(+) transporter OS=Caenorhabditis elegans OX=6239 GN=cua-1 PE=1 SV=1
4	AFDB:P35670	1.000	1.000	0.000	1465	1.000	1.000	P35670.pdb.gz	ATP7B_HUMAN Copper-transporting ATPase 2 OS=Homo sapiens OX=9606 GN=ATP7B PE=1 SV=4
5	AFDB:P70705	0.624	0.613	0.000	1492	0.571	0.561	P70705.pdb.gz	ATP7A_RAT Copper-transporting ATPase 1 OS=Rattus norvegicus OX=10116 GN=Atp7a PE=1 SV=1
6	AFDB:Q04656	0.625	0.611	0.000	1500	0.571	0.557	Q04656.pdb.gz	ATP7A_HUMAN Copper-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP7A PE=1 SV=4
7	AFDB:Q64446	0.684	0.685	0.000	1462	0.829	0.830	Q64446.pdb.gz	ATP7B_MOUSE Copper-transporting ATPase 2 OS=Mus musculus OX=10090 GN=Atp7b PE=1 SV=2
8	AFDB:Q9VYT4	0.590	0.686	0.000	1254	0.389	0.455	Q9VYT4.pdb.gz	Q9VYT4_DROME P-type Cu(+) transporter OS=Drosophila melanogaster OX=7227 GN=ATP7 PE=3 SV=3
9	AFDB:Q5B756	0.567	0.695	1.270E-94	1182	0.307	0.381	Q5B756.pdb.gz	Q5B756_EMENI Copper resistance P-type ATPase (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_03624 PE=3 SV=1
10	AFDB:Q4WQF3	0.513	0.627	2.367E-93	1187	0.302	0.372	Q4WQF3.pdb.gz	Q4WQF3_ASPFU Copper-transporting ATPase, putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_4G12620 PE=3 SV=1
11	PDB:4bbjA	0.324	0.640	7.384E-52	664	0.179	0.395	4bbjA.pdb.gz	Copper-Transporting P-Type Atpases Use a Unique Ion-Release Pathway
12	PDB:3j09A	0.271	0.467	2.577E-44	723	0.208	0.420	3j09A.pdb.gz
13	PDB:7nnlB	0.301	0.571	5.673E-32	682	0.100	0.214	7nnlB.pdb.gz	Deciphering ion transport and ATPase coupling in the intersubunit tunnel of KdpFABC.
14	PDB:7e7sA	0.294	0.403	3.677E-28	1020	0.098	0.140	7e7sA.pdb.gz	Cryo-EM analysis provides new mechanistic insight into ATP binding to Ca 2+ -ATPase SERCA2b.
15	PDB:7vh5A	0.318	0.544	4.729E-27	804	0.083	0.150	7vh5A.pdb.gz
16	PDB:5zmwA	0.280	0.388	2.034E-25	1000	0.097	0.142	5zmwA.pdb.gz	Mechanism of the E2 to E1 transition in Ca2+pump revealed by crystal structures of gating residue mutants.
17	PDB:7x20A	0.243	0.344	6.936E-24	986	0.087	0.130	7x20A.pdb.gz	Structure and function of H + /K + pump mutants reveal Na + /K + pump mechanisms.
18	PDB:8d3xA	0.263	0.373	6.751E-23	989	0.091	0.134	8d3xA.pdb.gz	Structural basis for gating mechanism of the human sodium-potassium pump.
19	PDB:3ixzA	0.262	0.367	7.408E-23	998	0.087	0.128	3ixzA.pdb.gz
20	PDB:3b8eA	0.254	0.354	8.681E-22	998	0.086	0.126	3b8eA.pdb.gz	Crystal structure of the sodium-potassium pump.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A669KA36	1271	1110	0.434	0.573	A0A669KA36_HUMAN P-type Cu(+) transporter (Fragment) OS=Homo sapiens OX=9606 GN=ATP7B PE=1 SV=1
2	A0A669KB88	1427	1387	0.504	0.532	A0A669KB88_HUMAN P-type Cu(+) transporter OS=Homo sapiens OX=9606 GN=ATP7B PE=1 SV=1
3	B7ZLR4	2891	1417	0.967	1.000	B7ZLR4_HUMAN P-type Cu(+) transporter OS=Homo sapiens OX=9606 GN=ATP7B PE=1 SV=1
4	E7ET55	1286	1381	0.428	0.454	E7ET55_HUMAN P-type Cu(+) transporter OS=Homo sapiens OX=9606 GN=ATP7B PE=1 SV=3
5	F1QEG1	1536	1482	0.558	0.551	F1QEG1_DANRE P-type Cu(+) transporter OS=Danio rerio OX=7955 GN=cal PE=3 SV=2
6	F5H748	1942	1400	0.652	0.682	F5H748_HUMAN P-type Cu(+) transporter OS=Homo sapiens OX=9606 GN=ATP7B PE=1 SV=1
7	G5ED40	870	1116	0.338	0.444	G5ED40_CAEEL P-type Cu(+) transporter OS=Caenorhabditis elegans OX=6239 GN=cua-1 PE=1 SV=1
8	G5EE14	896	1238	0.356	0.421	G5EE14_CAEEL P-type Cu(+) transporter OS=Caenorhabditis elegans OX=6239 GN=cua-1 PE=1 SV=1
9	O32220	573	802	0.237	0.433	COPA_BACSU Copper-exporting P-type ATPase OS=Bacillus subtilis (strain 168) OX=224308 GN=copA PE=1 SV=2
10	P35670	3014	1465	1.000	1.000	ATP7B_HUMAN Copper-transporting ATPase 2 OS=Homo sapiens OX=9606 GN=ATP7B PE=1 SV=4
11	P70705	1561	1492	0.574	0.564	ATP7A_RAT Copper-transporting ATPase 1 OS=Rattus norvegicus OX=10116 GN=Atp7a PE=1 SV=1
12	Q04656	1560	1500	0.563	0.550	ATP7A_HUMAN Copper-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP7A PE=1 SV=4
13	Q4F8H5	1534	1482	0.554	0.548	Q4F8H5_DANRE P-type Cu(+) transporter OS=Danio rerio OX=7955 GN=zgc:153422 PE=2 SV=1
14	Q4WQF3	648	1187	0.312	0.385	Q4WQF3_ASPFU Copper-transporting ATPase, putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_4G12620 PE=3 SV=1
15	Q54Q77	693	985	0.282	0.419	Q54Q77_DICDI P-type ATPase OS=Dictyostelium discoideum OX=44689 GN=atp7a PE=3 SV=1
16	Q5B756	608	1182	0.284	0.352	Q5B756_EMENI Copper resistance P-type ATPase (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_03624 PE=3 SV=1
17	Q64430	1557	1491	0.572	0.562	ATP7A_MOUSE Copper-transporting ATPase 1 OS=Mus musculus OX=10090 GN=Atp7a PE=1 SV=3
18	Q64446	2433	1462	0.829	0.831	ATP7B_MOUSE Copper-transporting ATPase 2 OS=Mus musculus OX=10090 GN=Atp7b PE=1 SV=2
19	Q64535	2395	1451	0.819	0.827	ATP7B_RAT Copper-transporting ATPase 2 OS=Rattus norvegicus OX=10116 GN=Atp7b PE=1 SV=1
20	Q9S7J8	640	1001	0.279	0.409	HMA7_ARATH Copper-transporting ATPase RAN1 OS=Arabidopsis thaliana OX=3702 GN=RAN1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19803 DUF6286	0.00039	32.3	Family of unknown function (DUF6286)
2	PF00122 E1-E2_ATPase	1.5e-43	159.9	E1-E2 ATPase
3	PF04828 GFA	3.2e+02	13.1	Glutathione-dependent formaldehyde-activating enzyme
4	PF12710 HAD	4.7e+02	12.7	haloacid dehalogenase-like hydrolase
5	PF13419 HAD_2	37	15.9	Haloacid dehalogenase-like hydrolase
6	PF00403 HMA	6e-81	278.1	Heavy-metal-associated domain
7	PF19991 HMA_2	5.4e-07	41.1	Heavy metal associated domain 2
8	PF00702 Hydrolase	3.4e-62	222.0	haloacid dehalogenase-like hydrolase
9	PF08282 Hydrolase_3	0.0014	30.1	haloacid dehalogenase-like hydrolase
10	PF13344 Hydrolase_6	13	17.2	Haloacid dehalogenase-like hydrolase
11	PF08777 RRM_3	57	15.2	RNA binding motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000242839

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000430598	0.999	Copper transport protein ATOX1
2	9606.ENSP00000308236	0.982	COMM domain-containing protein 1
3	9606.ENSP00000264613	0.921	Ceruloplasmin
4	9606.ENSP00000363329	0.887	High affinity copper uptake protein 1
5	9606.ENSP00000259392	0.867	Probable low affinity copper uptake protein 2
6	9606.ENSP00000436318	0.866	Copper chaperone for superoxide dismutase
7	9606.ENSP00000369314	0.836	Glutaredoxin-1
8	9606.ENSP00000261070	0.833	Cytochrome c oxidase copper chaperone
9	9606.ENSP00000416508	0.819	Probable cation-transporting ATPase 13A3
10	9606.ENSP00000345728	0.811	Copper-transporting ATPase 1
11	9606.ENSP00000414906	0.786	Dynactin subunit 4
12	9606.ENSP00000249910	0.748	Methyl-CpG-binding domain protein 4
13	9606.ENSP00000315130	0.747	Clusterin
14	9606.ENSP00000334216	0.729	Potassium-transporting ATPase subunit beta
15	9606.ENSP00000370213	0.720	H(+)/Cl(-) exchange transporter 4
16	9606.ENSP00000261867	0.714	Zinc transporter 4
17	9606.ENSP00000362127	0.714	Metal regulatory transcription factor 1
18	9606.ENSP00000255390	0.711	Protein SCO1 homolog, mitochondrial
19	9606.ENSP00000242819	0.707	Coiled-coil domain containing 70
20	9606.ENSP00000483879	0.705	XK-related protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1901702	0.997	salt transmembrane transporter activity
GO:1901682	0.997	sulfur compound transmembrane transporter activity
GO:0015662	0.997	P-type ion transporter activity
GO:0005375	0.997	copper ion transmembrane transporter activity
GO:0019829	0.997	ATPase-coupled monoatomic cation transmembrane transporter activity
GO:0005515	0.996	protein binding
GO:0005507	0.996	copper ion binding
GO:0030554	0.959	adenyl nucleotide binding
GO:0005524	0.938	ATP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0030001	0.986	metal ion transport
GO:0000041	0.978	transition metal ion transport
GO:0006825	0.963	copper ion transport
GO:0050896	0.938	response to stimulus
GO:0030003	0.893	intracellular monoatomic cation homeostasis
GO:0098771	0.889	inorganic ion homeostasis
GO:0042221	0.813	response to chemical
GO:0055070	0.703	copper ion homeostasis
GO:0006878	0.651	intracellular copper ion homeostasis
GO:0055085	0.645	transmembrane transport
GO:0065007	0.540	biological regulation
GO:0010035	0.475	response to inorganic substance
GO:0034220	0.471	monoatomic ion transmembrane transport
GO:0010038	0.453	response to metal ion
GO:0008152	0.439	metabolic process
GO:0071704	0.431	organic substance metabolic process
GO:0050789	0.407	regulation of biological process
GO:0050794	0.375	regulation of cellular process
GO:0006807	0.351	nitrogen compound metabolic process
GO:0051716	0.338	cellular response to stimulus
GO:0044238	0.309	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	0.998	Golgi apparatus
GO:0016020	0.986	membrane
GO:0031984	0.742	organelle subcompartment
GO:0005886	0.667	plasma membrane
GO:0098791	0.599	Golgi apparatus subcompartment
GO:0005802	0.522	trans-Golgi network
GO:0031982	0.458	vesicle
GO:0031410	0.402	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	0.997	Translocases.
RHEA:28703	0.997	Cu(2+)(in) = Cu(2+)(out)

[back to server]