StarFunc result for job id P35680

User Input

>input (557 residues)
MVSKLTSLQQELLSALLSSGVTKEVLVQALEELLPSPNFGVKLETLPLSPGSGAEPDTKP
VFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDPWR
AAKMIKGYMQQHNIPQREVVDVTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREIL
RQFNQTVQSSGNMTDKSSQDQLLFLFPEFSQQSHGPGQSDDACSEPTNKKMRRNRFKWGP
ASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSPSKAHGLGSNLVTEVRVYNWF
ANRRKEEAFRQKLAMDAYSSNQTHSLNPLLSHGSPHHQPSSSPPNKLSGVRYSQQGNNEI
TSSSTISHHGNSAMVTSQSVLQQVSPASLDPGHNLLSPDGKMISVSGGGLPPVSTLTNIH
SLSHHNPQQSQNLIMTPLSGVMAIAQSLNTSQAQSVPVINSVAGSLAALQPVQFSQQLHS
PHQQPLMQQSPGSHMAQQPFMAAVTQLQNSHMYAHKQEPPQYSHTSRFPSAMVVTDTSSI
STLTNMSSSKQCPLQAW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P27889	0.645	0.643	8.354E-62	558	0.964	0.962	P27889.pdb.gz	HNF1B_MOUSE Hepatocyte nuclear factor 1-beta OS=Mus musculus OX=10090 GN=Hnf1b PE=1 SV=2
2	AFDB:E0YMJ6	0.371	0.387	8.379E-58	531	0.946	0.992	E0YMJ6.pdb.gz	E0YMJ6_HUMAN HNF1 beta A splice variant 1 OS=Homo sapiens OX=9606 GN=HNF1B PE=2 SV=1
3	AFDB:A1L1N5	0.539	0.537	8.619E-52	559	0.817	0.814	A1L1N5.pdb.gz	HN1BA_DANRE Hepatocyte nuclear factor 1-beta-A OS=Danio rerio OX=7955 GN=hnf1ba PE=2 SV=2
4	AFDB:Q8UW00	0.518	0.541	2.450E-42	532	0.661	0.692	Q8UW00.pdb.gz	HN1BB_DANRE Hepatocyte nuclear factor 1-beta-B OS=Danio rerio OX=7955 GN=hnf1bb PE=2 SV=1
5	AFDB:F2Z4S1	0.335	0.334	1.631E-27	560	0.458	0.455	F2Z4S1.pdb.gz
6	AFDB:P70298	0.130	0.064	1.981E-6	1426	0.147	0.058	P70298.pdb.gz	CUX2_MOUSE Homeobox protein cut-like 2 OS=Mus musculus OX=10090 GN=Cux2 PE=2 SV=2
7	AFDB:H0YKT2	0.126	0.116	8.296E-6	618	0.172	0.155	H0YKT2.pdb.gz	H0YKT2_HUMAN POU domain protein (Fragment) OS=Homo sapiens OX=9606 GN=POU2F2 PE=1 SV=2
8	AFDB:Q9UIU6	0.089	0.067	1.080E-3	781	0.171	0.122	Q9UIU6.pdb.gz	SIX4_HUMAN Homeobox protein SIX4 OS=Homo sapiens OX=9606 GN=SIX4 PE=1 SV=2
9	AFDB:A0A024R9T6	0.073	0.071	2.293E-2	581	0.169	0.162	A0A024R9T6.pdb.gz	A0A024R9T6_HUMAN HCG17415, isoform CRA_a OS=Homo sapiens OX=9606 GN=SLAIN2 PE=2 SV=1
10	AFDB:Q54GH3	0.081	0.072	3.202E-2	663	0.144	0.121	Q54GH3.pdb.gz	TOM1_DICDI Target of Myb protein 1 OS=Dictyostelium discoideum OX=44689 GN=tom1 PE=1 SV=1
11	PDB:7pubCI	0.069	0.087	1.317	427	0.050	0.066	7pubCI.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
12	PDB:3dnvB	0.100	0.688	1.930	71	0.020	0.155	3dnvB.pdb.gz	Molecular mechanisms of HipA-mediated multidrug tolerance and its neutralization by HipB.
13	PDB:6cf1B	0.087	0.434	2.227	94	0.029	0.170	6cf1B.pdb.gz
14	PDB:1b0nA	0.089	0.439	2.450	103	0.020	0.107	1b0nA.pdb.gz	An evolutionary link between sporulation and prophage induction in the structure of a repressor:anti-repressor complex.
15	PDB:3gn5A	0.098	0.334	2.695	132	0.025	0.106	3gn5A.pdb.gz	Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.
16	PDB:5nr5A	0.059	0.195	2.695	113	0.016	0.080	5nr5A.pdb.gz
17	PDB:5b5rA	0.092	0.111	2.827	409	0.038	0.051	5b5rA.pdb.gz
18	PDB:1jftA	0.069	0.110	3.262	340	0.011	0.018	1jftA.pdb.gz	Role of residue 147 in the gene regulatory function of the Escherichia coli purine repressor.
19	PDB:7qp6y	0.054	0.045	3.764	697	0.039	0.032	7qp6y.pdb.gz	Conformational rearrangements upon start codon recognition in human 48S translation initiation complex.
20	PDB:6z5lA	0.086	0.144	4.142	251	0.048	0.108	6z5lA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WZC2	0.0	1051	548	0.919	0.934	A0A087WZC2_HUMAN HNF1 homeobox B OS=Homo sapiens OX=9606 GN=HNF1B PE=1 SV=1
2	A0A0C4DGS8	0.0	857	457	0.758	0.923	A0A0C4DGS8_HUMAN HNF1 homeobox B OS=Homo sapiens OX=9606 GN=HNF1B PE=1 SV=1
3	A1L1N5	0.0	856	559	0.820	0.818	HN1BA_DANRE Hepatocyte nuclear factor 1-beta-A OS=Danio rerio OX=7955 GN=hnf1ba PE=2 SV=2
4	E0YMJ6	0.0	1079	531	0.953	1.000	E0YMJ6_HUMAN HNF1 beta A splice variant 1 OS=Homo sapiens OX=9606 GN=HNF1B PE=2 SV=1
5	E0YMJ8	0.0	835	425	0.722	0.946	E0YMJ8_HUMAN HNF1 beta A splice variant 3 OS=Homo sapiens OX=9606 GN=HNF1B PE=1 SV=1
6	P15257	0.0	533	628	0.560	0.497	HNF1A_RAT Hepatocyte nuclear factor 1-alpha OS=Rattus norvegicus OX=10116 GN=Hnf1a PE=1 SV=1
7	P20823	0.0	540	631	0.562	0.496	HNF1A_HUMAN Hepatocyte nuclear factor 1-alpha OS=Homo sapiens OX=9606 GN=HNF1A PE=1 SV=2
8	P22361	0.0	531	628	0.562	0.498	HNF1A_MOUSE Hepatocyte nuclear factor 1-alpha OS=Mus musculus OX=10090 GN=Hnf1a PE=1 SV=2
9	P23899	0.0	1117	557	0.971	0.971	HNF1B_RAT Hepatocyte nuclear factor 1-beta OS=Rattus norvegicus OX=10116 GN=Hnf1b PE=1 SV=1
10	P27889	0.0	1108	558	0.964	0.962	HNF1B_MOUSE Hepatocyte nuclear factor 1-beta OS=Mus musculus OX=10090 GN=Hnf1b PE=1 SV=2
11	P35680	0.0	1147	557	1.000	1.000	HNF1B_HUMAN Hepatocyte nuclear factor 1-beta OS=Homo sapiens OX=9606 GN=HNF1B PE=1 SV=1
12	Q6FHW6	0.0	1147	557	1.000	1.000	Q6FHW6_HUMAN TCF2 protein OS=Homo sapiens OX=9606 GN=TCF2 PE=2 SV=1
13	Q8UW00	0.0	647	532	0.666	0.697	HN1BB_DANRE Hepatocyte nuclear factor 1-beta-B OS=Danio rerio OX=7955 GN=hnf1bb PE=2 SV=1
14	A0A087WXS2	3.42e-161	462	293	0.417	0.792	A0A087WXS2_HUMAN Hepatocyte nuclear factor 1-beta OS=Homo sapiens OX=9606 GN=HNF1B PE=4 SV=1
15	Q8UVH4	1.74e-142	425	560	0.467	0.464	Q8UVH4_DANRE HNF1 homeobox a OS=Danio rerio OX=7955 GN=tcf1 PE=2 SV=1
16	Q8BJA3	1.19e-11	68.9	419	0.176	0.234	HMBX1_MOUSE Homeobox-containing protein 1 OS=Mus musculus OX=10090 GN=Hmbox1 PE=1 SV=1
17	E5RGZ2	1.39e-10	65.5	386	0.127	0.184	E5RGZ2_HUMAN Homeobox containing 1 OS=Homo sapiens OX=9606 GN=HMBOX1 PE=1 SV=1
18	Q6NT76	2.25e-10	65.1	420	0.127	0.169	HMBX1_HUMAN Homeobox-containing protein 1 OS=Homo sapiens OX=9606 GN=HMBOX1 PE=1 SV=1
19	H0YKJ1	4.62e-10	63.9	396	0.108	0.152	H0YKJ1_HUMAN Homeobox containing 1 OS=Homo sapiens OX=9606 GN=HMBOX1 PE=1 SV=1
20	Q9TYT0	4.51e-04	45.1	424	0.072	0.094	HMBX1_CAEEL Homeobox-containing protein 1 OS=Caenorhabditis elegans OX=6239 GN=hmbx-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09949 APP1_cat	3.4e+02	12.5	Phosphatidate phosphatase APP1, catalytic domain
2	PF04812 HNF-1B_C	5e-114	391.9	Hepatocyte nuclear factor 1 (HNF-1), beta isoform C terminus
3	PF04814 HNF-1_N	4.5e-65	231.2	Hepatocyte nuclear factor 1 (HNF-1), N terminus
4	PF05920 Homeobox_KN	1.5e+02	13.7	Homeobox KN domain
5	PF00046 Homeodomain	0.13	23.4	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000480291

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302630	0.982	Hepatocyte nuclear factor 6
2	9606.ENSP00000365687	0.963	Pancreas transcription factor 1 subunit alpha
3	9606.ENSP00000312987	0.787	Hepatocyte nuclear factor 4-alpha
4	9606.ENSP00000299299	0.772	Pterin-4-alpha-carbinolamine dehydratase
5	9606.ENSP00000387699	0.745	Cyclic AMP-responsive element-binding protein 1
6	9606.ENSP00000370421	0.692	Pancreas/duodenum homeobox protein 1
7	9606.ENSP00000400341	0.665	Hepatocyte nuclear factor 3-beta
8	9606.ENSP00000223366	0.639	Glucokinase
9	9606.ENSP00000245479	0.634	Transcription factor SOX-9
10	9606.ENSP00000359319	0.631	Paired box protein Pax-2
11	9606.ENSP00000242462	0.629	Neurogenin-3
12	9606.ENSP00000282728	0.624	Hematopoietically-expressed homeobox protein HHEX
13	9606.ENSP00000370408	0.612	Homeobox protein CDX-2
14	9606.ENSP00000295108	0.609	Neurogenic differentiation factor 1
15	9606.ENSP00000295886	0.605	Homeobox protein Nkx-6.1
16	9606.ENSP00000274695	0.601	Threonylcarbamoyladenosine tRNA methylthiotransferase
17	9606.ENSP00000304004	0.585	Hepatocyte nuclear factor 3-gamma
18	9606.ENSP00000379438	0.585	Uromodulin
19	9606.ENSP00000297316	0.577	Transcription factor SOX-17
20	9606.ENSP00000357581	0.577	Homeobox protein Nkx-6.2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000987	0.999	cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0009987	0.980	cellular process
GO:0031323	0.979	regulation of cellular metabolic process
GO:0048856	0.976	anatomical structure development
GO:0032501	0.974	multicellular organismal process
GO:0045893	0.972	positive regulation of DNA-templated transcription
GO:0009888	0.965	tissue development
GO:0007275	0.961	multicellular organism development
GO:0048513	0.941	animal organ development
GO:0048731	0.929	system development
GO:0006357	0.876	regulation of transcription by RNA polymerase II
GO:0045944	0.747	positive regulation of transcription by RNA polymerase II
GO:0060429	0.730	epithelium development
GO:0050896	0.679	response to stimulus
GO:0009653	0.651	anatomical structure morphogenesis
GO:0048869	0.607	cellular developmental process
GO:0030154	0.599	cell differentiation
GO:0048519	0.591	negative regulation of biological process
GO:0048523	0.517	negative regulation of cellular process
GO:0065008	0.410	regulation of biological quality
GO:0051716	0.410	cellular response to stimulus
GO:0007154	0.408	cell communication
GO:0009892	0.395	negative regulation of metabolic process
GO:0023052	0.387	signaling
GO:0010605	0.386	negative regulation of macromolecule metabolic process
GO:0031324	0.383	negative regulation of cellular metabolic process
GO:0042221	0.346	response to chemical
GO:0009890	0.346	negative regulation of biosynthetic process
GO:0010558	0.344	negative regulation of macromolecule biosynthetic process
GO:0051172	0.338	negative regulation of nitrogen compound metabolic process
GO:0031327	0.329	negative regulation of cellular biosynthetic process
GO:0008152	0.324	metabolic process
GO:0023051	0.315	regulation of signaling
GO:0001822	0.301	kidney development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.344	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]