StarFunc result for job id P35712

User Input

>input (828 residues)
MSSKQATSPFACAADGEDAMTQDLTSREKEEGSDQHVASHLPLHPIMHNKPHSEELPTLV
STIQQDADWDSVLSSQQRMESENNKLCSLYSFRNTSTSPHKPDEGSRDREIMTSVTFGTP
ERRKGSLADVVDTLKQKKLEEMTRTEQEDSSCMEKLLSKDWKEKMERLNTSELLGEIKGT
PESLAEKERQLSTMITQLISLREQLLAAHDEQKKLAASQIEKQRQQMDLARQQQEQIARQ
QQQLLQQQHKINLLQQQIQVQGHMPPLMIPIFPHDQRTLAAAAAAQQGFLFPPGITYKPG
DNYPVQFIPSTMAAAAASGLSPLQLQKGHVSHPQINQRLKGLSDRFGRNLDTFEHGGGHS
YNHKQIEQLYAAQLASMQVSPGAKMPSTPQPPNTAGTVSPTGIKNEKRGTSPVTQVKDEA
AAQPLNLSSRPKTAEPVKSPTSPTQNLFPASKTSPVNLPNKSSIPSPIGGSLGRGSSLDI
LSSLNSPALFGDQDTVMKAIQEARKMREQIQREQQQQQPHGVDGKLSSINNMGLNSCRNE
KERTRFENLGPQLTGKSNEDGKLGPGVIDLTRPEDAEGSKAMNGSAAKLQQYYCWPTGGA
TVAEARVYRDARGRASSEPHIKRPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWK
SMSNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPKRTCIVDGKKLRIGEYKQLMRSRRQE
MRQFFTVGQQPQIPITTGTGVVYPGAITMATTTPSPQMTSDCSSTSASPEPSLPVIQSTY
GMKTDGGSLAGNEMINGEDEMEMYDDYEDDPKSDYSSENEAPEAVSAN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P35712	0.999	0.999	0.000	828	1.000	1.000	P35712.pdb.gz	SOX6_HUMAN Transcription factor SOX-6 OS=Homo sapiens OX=9606 GN=SOX6 PE=1 SV=3
2	AFDB:P40647	0.175	0.190	5.728E-57	757	0.550	0.601	P40647.pdb.gz	SOX5_XENLA Transcription factor Sox-5 OS=Xenopus laevis OX=8355 GN=sox5 PE=2 SV=2
3	AFDB:F1M8W4	0.134	0.144	3.239E-53	763	0.545	0.591	F1M8W4.pdb.gz	SOX5_RAT Transcription factor SOX-5 OS=Rattus norvegicus OX=10116 GN=Sox5 PE=1 SV=2
4	AFDB:B3DJE0	0.141	0.151	4.859E-52	759	0.516	0.563	B3DJE0.pdb.gz
5	AFDB:F1Q6M9	0.092	0.033	6.297E-7	2623	0.173	0.055	F1Q6M9.pdb.gz	F1Q6M9_DANRE Capicua transcriptional repressor b OS=Danio rerio OX=7955 GN=cicb PE=4 SV=2
6	AFDB:Q9XVN3	0.057	0.060	9.805E-4	769	0.116	0.125	Q9XVN3.pdb.gz	IASPP_CAEEL Apoptotic enhancer 1 protein OS=Caenorhabditis elegans OX=6239 GN=ape-1 PE=1 SV=1
7	PDB:1j5nA	0.080	0.613	1.843E-3	93	0.025	0.226	1j5nA.pdb.gz	The S. cerevisiae architectural HMGB protein NHP6A complexed with DNA: DNA and protein conformational changes upon binding
8	AFDB:F1Q4W7	0.062	0.042	2.126E-3	1454	0.171	0.098	F1Q4W7.pdb.gz	F1Q4W7_DANRE Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Danio rerio OX=7955 GN=dot1l PE=1 SV=2
9	AFDB:Q9JM52	0.095	0.064	4.320E-3	1308	0.156	0.099	Q9JM52.pdb.gz	MINK1_MOUSE Misshapen-like kinase 1 OS=Mus musculus OX=10090 GN=Mink1 PE=1 SV=3
10	AFDB:P35658	0.060	0.030	1.066E-2	2090	0.162	0.064	P35658.pdb.gz	NU214_HUMAN Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2
11	AFDB:Q5YL88	0.086	0.068	1.137E-2	1205	0.178	0.122	Q5YL88.pdb.gz	Q5YL88_MOUSE Histone-lysine N-methyltransferase, H3 lysine-79 specific (Fragment) OS=Mus musculus OX=10090 GN=Dot1l PE=2 SV=1
12	PDB:6sklB	0.045	0.144	5.469	193	0.023	0.098	6sklB.pdb.gz	Cryo-EM Structure of the Fork Protection Complex Bound to CMG at a Replication Fork.
13	PDB:5x62B	0.040	0.069	6.222	387	0.013	0.028	5x62B.pdb.gz	Substrate Recognition Mechanism of the Putative Yeast Carnosine N-methyltransferase
14	PDB:3k2sA	0.061	0.166	7.078	243	0.039	0.132	3k2sA.pdb.gz	Double superhelix model of high density lipoprotein.
15	PDB:5apnh	0.045	0.151	7.078	119	0.021	0.143	5apnh.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
16	PDB:6hivAg	0.051	0.126	7.078	259	0.025	0.081	6hivAg.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
17	PDB:4kxrB	0.043	0.137	8.052	174	0.008	0.040	4kxrB.pdb.gz
18	PDB:6dv9F	0.037	0.136	8.052	174	0.018	0.086	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.
19	PDB:3jd5d	0.085	0.280	9.161	176	0.030	0.142	3jd5d.pdb.gz	Cryo-EM structure of the small subunit of the mammalian mitochondrial ribosome.
20	PDB:6qnxA	0.045	0.040	9.161	928	0.010	0.009	6qnxA.pdb.gz	The structural basis for cohesin-CTCF-anchored loops.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JTZ2	0.0	1660	827	0.966	0.967	SOX6_RAT Transcription factor SOX-6 OS=Rattus norvegicus OX=10116 GN=Sox6 PE=1 SV=2
2	F1M8W4	0.0	731	763	0.575	0.624	SOX5_RAT Transcription factor SOX-5 OS=Rattus norvegicus OX=10116 GN=Sox5 PE=1 SV=2
3	F8W2H3	0.0	1171	768	0.739	0.797	F8W2H3_DANRE SRY-box containing protein 6 OS=Danio rerio OX=7955 GN=fc35a10 PE=1 SV=2
4	P35710	0.0	725	763	0.557	0.604	SOX5_MOUSE Transcription factor SOX-5 OS=Mus musculus OX=10090 GN=Sox5 PE=1 SV=2
5	P35711	0.0	740	763	0.558	0.606	SOX5_HUMAN Transcription factor SOX-5 OS=Homo sapiens OX=9606 GN=SOX5 PE=1 SV=3
6	P35712	0.0	1719	828	1.000	1.000	SOX6_HUMAN Transcription factor SOX-6 OS=Homo sapiens OX=9606 GN=SOX6 PE=1 SV=3
7	P40645	0.0	1663	827	0.969	0.970	SOX6_MOUSE Transcription factor SOX-6 OS=Mus musculus OX=10090 GN=Sox6 PE=1 SV=2
8	P40647	0.0	695	757	0.568	0.621	SOX5_XENLA Transcription factor Sox-5 OS=Xenopus laevis OX=8355 GN=sox5 PE=2 SV=2
9	Q3ZM07	0.0	665	759	0.516	0.563	Q3ZM07_DANRE SRY-box-containing protein 5 OS=Danio rerio OX=7955 GN=id:ibd5067 PE=1 SV=1
10	Q04891	8.24e-63	224	613	0.198	0.268	SOX13_MOUSE Transcription factor SOX-13 OS=Mus musculus OX=10090 GN=Sox13 PE=1 SV=4
11	Q9UN79	9.14e-63	224	622	0.188	0.251	SOX13_HUMAN Transcription factor SOX-13 OS=Homo sapiens OX=9606 GN=SOX13 PE=1 SV=3
12	Q9V480	4.33e-56	205	580	0.105	0.150	Q9V480_DROME Sox102F, isoform A OS=Drosophila melanogaster OX=7227 GN=Sox102F PE=4 SV=1
13	Q59DN5	9.90e-56	204	618	0.105	0.141	Q59DN5_DROME FI18025p1 OS=Drosophila melanogaster OX=7227 GN=Sox102F PE=2 SV=1
14	O57396	3.34e-55	202	585	0.110	0.156	O57396_ONCMY RtSox23 OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
15	Q23045	2.41e-52	191	470	0.095	0.168	EGL13_CAEEL Transcription factor egl-13 OS=Caenorhabditis elegans OX=6239 GN=egl-13 PE=1 SV=2
16	Q6TEN5	8.85e-27	115	390	0.065	0.138	Q6TEN5_DANRE SRY-box 7 OS=Danio rerio OX=7955 GN=SOX7 PE=2 SV=1
17	Q90ZH9	2.40e-26	114	377	0.058	0.127	S17AB_XENLA Transcription factor Sox-17-alpha-B OS=Xenopus laevis OX=8355 GN=sox17a-b PE=1 SV=1
18	Q5PQZ5	6.25e-25	110	413	0.058	0.116	Q5PQZ5_DANRE SRY-box 17 OS=Danio rerio OX=7955 GN=sox17 PE=2 SV=1
19	Q61473	6.39e-25	110	419	0.058	0.115	SOX17_MOUSE Transcription factor SOX-17 OS=Mus musculus OX=10090 GN=Sox17 PE=1 SV=1
20	P40656	1.27e-24	112	669	0.062	0.076	SOX14_DROME Putative transcription factor SOX-14 OS=Drosophila melanogaster OX=7227 GN=Sox14 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00505 HMG_box	6.4e-19	79.5	HMG (high mobility group) box
2	PF09011 HMG_box_2	6.5e-06	38.0	HMG-box domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003818248.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008949747.1	0.869	Catenin beta 1
2	9597.XP_003816339.1	0.729	C-terminal binding protein 2
3	9597.XP_008954526.1	0.719	B-cell CLL/lymphoma 11A
4	9597.XP_003820015.1	0.703	Brain-specific homeobox protein homolog
5	9597.XP_003804377.2	0.701	Transcription factor SOX-9-like
6	9597.XP_008973561.1	0.679	Thyroid hormone receptor interactor 12
7	9597.XP_003807270.1	0.644	GATA binding protein 1
8	9597.XP_003825106.1	0.629	Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Myosin family
9	9597.XP_008949371.1	0.617	Collagen alpha-1(II) chain
10	9597.XP_008972113.1	0.614	Aggrecan core protein isoform X1
11	9597.XP_008963627.1	0.603	Forkhead box protein J3 isoform X1
12	9597.XP_008959204.1	0.598	SRY-box 8
13	9597.XP_003833262.1	0.596	Runt related transcription factor 2
14	9597.XP_003805296.1	0.591	Purine rich element binding protein B
15	9597.XP_008976675.1	0.590	Sulfhydryl oxidase 1
16	9597.XP_008961414.1	0.588	DAZ associated protein 2
17	9597.XP_003808044.1	0.566	Zinc finger and BTB domain-containing protein 18 isoform X1
18	9597.XP_008961496.1	0.557	Polypyrimidine tract binding protein 3
19	9597.XP_003829307.1	0.550	Neurogenin-1
20	9597.XP_003811844.1	0.547	Forkhead box protein J2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0000976	1.000	transcription cis-regulatory region binding
GO:0042802	0.925	identical protein binding
GO:0046983	0.901	protein dimerization activity
GO:0042803	0.887	protein homodimerization activity
GO:0000987	0.813	cis-regulatory region sequence-specific DNA binding
GO:0000981	0.658	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.355	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048856	0.996	anatomical structure development
GO:0007275	0.990	multicellular organism development
GO:0009987	0.987	cellular process
GO:0048513	0.974	animal organ development
GO:0030154	0.962	cell differentiation
GO:0045165	0.953	cell fate commitment
GO:0050794	0.928	regulation of cellular process
GO:0048731	0.909	system development
GO:0048518	0.881	positive regulation of biological process
GO:0007399	0.859	nervous system development
GO:0009888	0.851	tissue development
GO:0048519	0.837	negative regulation of biological process
GO:0050793	0.832	regulation of developmental process
GO:0051239	0.823	regulation of multicellular organismal process
GO:0045595	0.806	regulation of cell differentiation
GO:0048522	0.801	positive regulation of cellular process
GO:0048523	0.796	negative regulation of cellular process
GO:0050896	0.756	response to stimulus
GO:0019222	0.755	regulation of metabolic process
GO:0060255	0.748	regulation of macromolecule metabolic process
GO:0080090	0.739	regulation of primary metabolic process
GO:0051171	0.739	regulation of nitrogen compound metabolic process
GO:0031323	0.739	regulation of cellular metabolic process
GO:0010468	0.735	regulation of gene expression
GO:2000026	0.734	regulation of multicellular organismal development
GO:0019219	0.732	regulation of nucleobase-containing compound metabolic process
GO:0007417	0.728	central nervous system development
GO:0051252	0.673	regulation of RNA metabolic process
GO:0010556	0.667	regulation of macromolecule biosynthetic process
GO:0031326	0.667	regulation of cellular biosynthetic process
GO:0051240	0.657	positive regulation of multicellular organismal process
GO:2001141	0.633	regulation of RNA biosynthetic process
GO:0071495	0.568	cellular response to endogenous stimulus
GO:0045597	0.537	positive regulation of cell differentiation
GO:0006355	0.532	regulation of DNA-templated transcription
GO:0010604	0.531	positive regulation of macromolecule metabolic process
GO:0051173	0.523	positive regulation of nitrogen compound metabolic process
GO:0031325	0.523	positive regulation of cellular metabolic process
GO:0051093	0.490	negative regulation of developmental process
GO:0006357	0.484	regulation of transcription by RNA polymerase II
GO:0051241	0.470	negative regulation of multicellular organismal process
GO:0051172	0.455	negative regulation of nitrogen compound metabolic process
GO:0031324	0.451	negative regulation of cellular metabolic process
GO:0008152	0.448	metabolic process
GO:0010605	0.448	negative regulation of macromolecule metabolic process
GO:0045934	0.443	negative regulation of nucleobase-containing compound metabolic process
GO:0022008	0.424	neurogenesis
GO:0065009	0.423	regulation of molecular function
GO:0045893	0.419	positive regulation of DNA-templated transcription
GO:0071363	0.409	cellular response to growth factor stimulus
GO:0045944	0.407	positive regulation of transcription by RNA polymerase II
GO:0061061	0.402	muscle structure development
GO:0048468	0.392	cell development
GO:0061448	0.376	connective tissue development
GO:0009653	0.356	anatomical structure morphogenesis
GO:0051253	0.350	negative regulation of RNA metabolic process
GO:0042063	0.347	gliogenesis
GO:0010001	0.327	glial cell differentiation
GO:0000122	0.321	negative regulation of transcription by RNA polymerase II
GO:0060537	0.305	muscle tissue development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.997	protein-containing complex
GO:0005667	0.953	transcription regulator complex
GO:0043232	0.819	intracellular non-membrane-bounded organelle
GO:0005737	0.722	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]