StarFunc result for job id P35716

User Input

>input (441 residues)
MVQQAESLEAESNLPREALDTEEGEFMACSPVALDESDPDWCKTASGHIKRPMNAFMVWS
KIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRP
RKKPKMDPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKKCGKLKAPAAAGAKA
GAGKAAQSGDYGGAGDDYVLGSLRVSGSGGGGAGKTVKCVFLDEDDDDDDDDDELQLQIK
QEPDEEDEEPPHQQLLQPPGQQPSQLLRRYNVAKVPASPTLSSSAESPEGASLYDEVRAG
ATSGAGGGSRLYYSFKNITKQHPPPLAQPALSPASSRSVSTSSSSSSGSSSGSSGEDADD
LMFDLSLNFSQSAHSASEQQLGGGAAAGNLSLSLVDKDLDSFSEGSLGSHFEFPDYCTPE
LSEMIAGDWLEANFSDLVFTY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P35716	1.000	1.000	1.084E-59	441	1.000	1.000	P35716.pdb.gz	SOX11_HUMAN Transcription factor SOX-11 OS=Homo sapiens OX=9606 GN=SOX11 PE=1 SV=2
2	AFDB:P0C1G9	0.407	0.449	2.715E-43	395	0.789	0.881	P0C1G9.pdb.gz	SOX11_RAT Transcription factor SOX-11 OS=Rattus norvegicus OX=10116 GN=Sox11 PE=2 SV=1
3	AFDB:P48435	0.320	0.351	2.828E-38	396	0.692	0.770	P48435.pdb.gz	SOX11_CHICK Transcription factor SOX-11 OS=Gallus gallus OX=9031 GN=SOX11 PE=2 SV=1
4	AFDB:Q06945	0.226	0.212	5.835E-22	474	0.417	0.388	Q06945.pdb.gz	SOX4_HUMAN Transcription factor SOX-4 OS=Homo sapiens OX=9606 GN=SOX4 PE=1 SV=1
5	AFDB:Q06831	0.222	0.223	1.187E-21	440	0.420	0.420	Q06831.pdb.gz	SOX4_MOUSE Transcription factor SOX-4 OS=Mus musculus OX=10090 GN=Sox4 PE=1 SV=2
6	AFDB:F1Q6M9	0.165	0.030	1.891E-5	2623	0.211	0.035	F1Q6M9.pdb.gz	F1Q6M9_DANRE Capicua transcriptional repressor b OS=Danio rerio OX=7955 GN=cicb PE=4 SV=2
7	AFDB:Q8IMA8	0.160	0.062	2.724E-3	1192	0.159	0.059	Q8IMA8.pdb.gz	PANG2_DROME Protein pangolin, isoform J OS=Drosophila melanogaster OX=7227 GN=pan PE=1 SV=2
8	PDB:1j5nA	0.141	0.609	1.266E-2	93	0.039	0.183	1j5nA.pdb.gz	The S. cerevisiae architectural HMGB protein NHP6A complexed with DNA: DNA and protein conformational changes upon binding
9	AFDB:P62598	0.068	0.058	3.031E-1	596	0.127	0.094	P62598.pdb.gz	ARR12_ARATH Two-component response regulator ARR12 OS=Arabidopsis thaliana OX=3702 GN=ARR12 PE=2 SV=2
10	AFDB:Q94AJ9	0.075	0.049	4.464E-1	767	0.166	0.095	Q94AJ9.pdb.gz	Q94AJ9_ARATH Nucleic acid-binding, OB-fold-like protein OS=Arabidopsis thaliana OX=3702 GN=SDP PE=1 SV=1
11	AFDB:P15207	0.057	0.036	5.779E-1	902	0.170	0.083	P15207.pdb.gz	ANDR_RAT Androgen receptor OS=Rattus norvegicus OX=10116 GN=Ar PE=1 SV=1
12	PDB:7ploI	0.104	0.102	1.020	451	0.027	0.027	7ploI.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
13	PDB:7mqaNA	0.076	0.101	1.502	295	0.050	0.075	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:5b63C	0.067	0.055	2.518	553	0.025	0.020	5b63C.pdb.gz	Crystal structures of E.coli arginyl-tRNA synthetase (ArgRS) in complex with substrate tRNA(Arg)
15	PDB:2cyyA	0.059	0.152	3.055	151	0.036	0.106	2cyyA.pdb.gz	Crystal structure of PH1519 from Pyrococcus horikosii OT3
16	PDB:7fbyA	0.044	0.121	3.708	153	0.016	0.046	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
17	PDB:7cpuSN	0.073	0.162	3.955	150	0.029	0.087	7cpuSN.pdb.gz	A male germ-cell-specific ribosome controls male fertility.
18	PDB:2gqqC	0.058	0.141	4.500	157	0.025	0.070	2gqqC.pdb.gz
19	PDB:2hh7A	0.055	0.230	6.629	85	0.020	0.106	2hh7A.pdb.gz
20	PDB:7lciR	0.071	0.078	7.071	393	0.025	0.028	7lciR.pdb.gz	Evolving cryo-EM structural approaches for GPCR drug discovery.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P35716	0.0	890	441	1.000	1.000	SOX11_HUMAN Transcription factor SOX-11 OS=Homo sapiens OX=9606 GN=SOX11 PE=1 SV=2
2	P0C1G9	5.65e-178	504	395	0.746	0.833	SOX11_RAT Transcription factor SOX-11 OS=Rattus norvegicus OX=10116 GN=Sox11 PE=2 SV=1
3	Q7M6Y2	2.19e-177	503	395	0.746	0.833	SOX11_MOUSE Transcription factor SOX-11 OS=Mus musculus OX=10090 GN=Sox11 PE=1 SV=1
4	P48435	7.32e-172	489	396	0.707	0.788	SOX11_CHICK Transcription factor SOX-11 OS=Gallus gallus OX=9031 GN=SOX11 PE=2 SV=1
5	Q91731	2.64e-158	454	382	0.601	0.694	SX11A_XENLA Transcription factor Sox-11-A OS=Xenopus laevis OX=8355 GN=sox11-a PE=1 SV=2
6	P40650	2.83e-154	443	374	0.587	0.693	SX11B_XENLA Transcription factor Sox-11-B OS=Xenopus laevis OX=8355 GN=sox11-b PE=1 SV=2
7	O57399	2.36e-135	395	367	0.583	0.700	O57399_ONCMY Transcription factor SOX OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00079394001 PE=2 SV=1
8	Q9I9C8	6.22e-124	365	354	0.551	0.686	Q9I9C8_DANRE Transcription factor SOX OS=Danio rerio OX=7955 GN=cb237 PE=2 SV=1
9	Q9I9C7	2.75e-66	218	368	0.261	0.312	Q9I9C7_DANRE Transcription factor SOX OS=Danio rerio OX=7955 GN=fc90d10 PE=2 SV=1
10	Q6P0Z4	1.47e-54	187	363	0.213	0.259	Q6P0Z4_DANRE Transcription factor SOX OS=Danio rerio OX=7955 GN=sox4 PE=2 SV=2
11	Q6P2A2	2.61e-54	186	342	0.200	0.257	Q6P2A2_DANRE Transcription factor SOX OS=Danio rerio OX=7955 GN=zgc:63851 PE=2 SV=1
12	Q9DG48	3.09e-53	184	379	0.184	0.214	Q9DG48_XENLA Transcription factor SOX OS=Xenopus laevis OX=8355 GN=Sox4 PE=2 SV=1
13	Q06831	3.52e-53	186	440	0.215	0.216	SOX4_MOUSE Transcription factor SOX-4 OS=Mus musculus OX=10090 GN=Sox4 PE=1 SV=2
14	A0A8I5ZQY6	3.91e-53	186	440	0.215	0.216	A0A8I5ZQY6_RAT Transcription factor SOX OS=Rattus norvegicus OX=10116 GN=Sox4 PE=4 SV=1
15	Q06945	1.55e-52	185	474	0.186	0.173	SOX4_HUMAN Transcription factor SOX-4 OS=Homo sapiens OX=9606 GN=SOX4 PE=1 SV=1
16	O15370	5.44e-49	171	315	0.172	0.241	SOX12_HUMAN Transcription factor SOX-12 OS=Homo sapiens OX=9606 GN=SOX12 PE=2 SV=2
17	Q04890	5.58e-49	171	314	0.172	0.242	SOX12_MOUSE Transcription factor SOX-12 OS=Mus musculus OX=10090 GN=Sox12 PE=1 SV=2
18	Q8AXQ4	1.46e-45	160	244	0.145	0.262	SOX12_XENLA Transcription factor Sox-12 OS=Xenopus laevis OX=8355 GN=sox12 PE=2 SV=1
19	P43267	2.55e-34	130	231	0.143	0.273	SOX15_MOUSE Protein SOX-15 OS=Mus musculus OX=10090 GN=Sox15 PE=1 SV=3
20	Q24533	5.64e-34	132	382	0.129	0.149	DICH_DROME SOX domain-containing protein dichaete OS=Drosophila melanogaster OX=7227 GN=D PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00505 HMG_box	4e-23	92.9	HMG (high mobility group) box
2	PF09011 HMG_box_2	5.3e-05	35.0	HMG-box domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000322568

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000367034	0.823	Histone cluster 1 H4 family member c
2	9606.ENSP00000349430	0.817	Histone H2B type 1-K
3	9606.ENSP00000244537	0.816	Histone cluster 1 H4 family member f
4	9606.ENSP00000347168	0.816	Histone cluster 1 H4 family member j
5	9606.ENSP00000366956	0.816	Histone cluster 1 H4 family member h
6	9606.ENSP00000366974	0.816	Histone cluster 1 H4 family member b
7	9606.ENSP00000443017	0.816	Histone cluster 4, H4
8	9606.ENSP00000462355	0.816	Histone cluster 2 H4 family member b
9	9606.ENSP00000462667	0.816	Histone cluster 2 H4 family member a
10	9606.ENSP00000479106	0.816	Histone cluster 1 H4 family member a
11	9606.ENSP00000479461	0.816	Histone cluster 1 H4 family member d
12	9606.ENSP00000479794	0.816	Histone cluster 1 H4 family member k
13	9606.ENSP00000480960	0.816	Histone cluster 1 H4 family member l
14	9606.ENSP00000481486	0.816	Histone cluster 1 H4 family member i
15	9606.ENSP00000484789	0.816	Histone H4
16	9606.ENSP00000303373	0.813	Histone cluster 1 H2A family member e
17	9606.ENSP00000483842	0.813	Histone H2A type 1-B/E
18	9606.ENSP00000333277	0.810	Histone cluster 2 H3 family member d
19	9606.ENSP00000358154	0.810	Histone cluster 2 H3 family member c
20	9606.ENSP00000385479	0.810	Histone H3.2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000978	0.997	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0005515	0.987	protein binding
GO:0140110	0.966	transcription regulator activity
GO:0003700	0.949	DNA-binding transcription factor activity
GO:0000981	0.776	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0032502	0.995	developmental process
GO:0032501	0.995	multicellular organismal process
GO:0007275	0.988	multicellular organism development
GO:0009987	0.977	cellular process
GO:0048518	0.975	positive regulation of biological process
GO:0010468	0.973	regulation of gene expression
GO:0048519	0.969	negative regulation of biological process
GO:0023051	0.963	regulation of signaling
GO:0048522	0.958	positive regulation of cellular process
GO:0051171	0.957	regulation of nitrogen compound metabolic process
GO:0048731	0.945	system development
GO:0009893	0.922	positive regulation of metabolic process
GO:0010646	0.920	regulation of cell communication
GO:0048523	0.911	negative regulation of cellular process
GO:0010604	0.903	positive regulation of macromolecule metabolic process
GO:0080090	0.887	regulation of primary metabolic process
GO:0006355	0.866	regulation of DNA-templated transcription
GO:0007399	0.851	nervous system development
GO:0048583	0.812	regulation of response to stimulus
GO:0050793	0.783	regulation of developmental process
GO:0045595	0.758	regulation of cell differentiation
GO:0006357	0.746	regulation of transcription by RNA polymerase II
GO:0045893	0.741	positive regulation of DNA-templated transcription
GO:0051239	0.740	regulation of multicellular organismal process
GO:0048869	0.726	cellular developmental process
GO:0045944	0.709	positive regulation of transcription by RNA polymerase II
GO:0030154	0.704	cell differentiation
GO:0010605	0.673	negative regulation of macromolecule metabolic process
GO:0045892	0.655	negative regulation of DNA-templated transcription
GO:2000026	0.636	regulation of multicellular organismal development
GO:0048513	0.574	animal organ development
GO:0042127	0.557	regulation of cell population proliferation
GO:0009966	0.516	regulation of signal transduction
GO:0050896	0.514	response to stimulus
GO:0000122	0.432	negative regulation of transcription by RNA polymerase II
GO:0060284	0.312	regulation of cell development
GO:0051093	0.305	negative regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0016020	0.977	membrane
GO:0005886	0.839	plasma membrane
GO:0005737	0.655	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]