StarFunc result for job id P35749

User Input

>input (1972 residues)
MAQKGQLSDDEKFLFVDKNFINSPVAQADWAAKRLVWVPSEKQGFEAASIKEEKGDEVVV
ELVENGKKVTVGKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLRERYFSGLIYTYSGL
FCVVVNPYKHLPIYSEKIVDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGES
GAGKTENTKKVIQYLAVVASSHKGKKDTSITGELEKQLLQANPILEAFGNAKTVKNDNSS
RFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQARDERTFHIFYYMIAGAKEKMRSDLL
LEGFNNYTFLSNGFVPIPAAQDDEMFQETVEAMAIMGFSEEEQLSILKVVSSVLQLGNIV
FKKERNTDQASMPDNTAAQKVCHLMGINVTDFTRSILTPRIKVGRDVVQKAQTKEQADFA
VEALAKATYERLFRWILTRVNKALDKTHRQGASFLGILDIAGFEIFEVNSFEQLCINYTN
EKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPNNPPGVLALLDEECW
FPKATDKSFVEKLCTEQGSHPKFQKPKQLKDKTEFSIIHYAGKVDYNASAWLTKNMDPLN
DNVTSLLNASSDKFVADLWKDVDRIVGLDQMAKMTESSLPSASKTKKGMFRTVGQLYKEQ
LGKLMTTLRNTTPNFVRCIIPNHEKRSGKLDAFLVLEQLRCNGVLEGIRICRQGFPNRIV
FQEFRQRYEILAANAIPKGFMDGKQACILMIKALELDPNLYRIGQSKIFFRTGVLAHLEE
ERDLKITDVIMAFQAMCRGYLARKAFAKRQQQLTAMKVIQRNCAAYLKLRNWQWWRLFTK
VKPLLQVTRQEEEMQAKEDELQKTKERQQKAENELKELEQKHSQLTEEKNLLQEQLQAET
ELYAEAEEMRVRLAAKKQELEEILHEMEARLEEEEDRGQQLQAERKKMAQQMLDLEEQLE
EEEAARQKLQLEKVTAEAKIKKLEDEILVMDDQNNKLSKERKLLEERISDLTTNLAEEEE
KAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKLKRKLEGDASDFHEQIADLQAQIAE
LKMQLAKKEEELQAALARLDDEIAQKNNALKKIRELEGHISDLQEDLDSERAARNKAEKQ
KRDLGEELEALKTELEDTLDSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQK
HAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQ
VQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASLSSQLQDT
QELLQEETRQKLNVSTKLRQLEEERNSLQDQLDEEMEAKQNLERHISTLNIQLSDSKKKL
QDFASTVEALEEGKKRFQKEIENLTQQYEEKAAAYDKLEKTKNRLQQELDDLVVDLDNQR
QLVSNLEKKQRKFDQLLAEEKNISSKYADERDRAEAEAREKETKALSLARALEEALEAKE
ELERTNKMLKAEMEDLVSSKDDVGKNVHELEKSKRALETQMEEMKTQLEELEDELQATED
AKLRLEVNMQALKGQFERDLQARDEQNEEKRRQLQRQLHEYETELEDERKQRALAAAAKK
KLEGDLKDLELQADSAIKGREEAIKQLRKLQAQMKDFQRELEDARASRDEIFATAKENEK
KAKSLEADLMQLQEDLAAAERARKQADLEKEELAEELASSLSGRNALQDEKRRLEARIAQ
LEEELEEEQGNMEAMSDRVRKATQQAEQLSNELATERSTAQKNESARQQLERQNKELRSK
LHEMEGAVKSKFKSTIAALEAKIAQLEEQVEQEAREKQAATKSLKQKDKKLKEILLQVED
ERKMAEQYKEQAEKGNARVKQLKRQLEEAEEESQRINANRRKLQRELDEATESNEAMGRE
VNALKSKLRRGNETSFVPSRRSGGRRVIENADGSEEETDTRDADFNGTKASE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0N4STT5	0.653	0.642	0.000	2008	0.395	0.388	A0A0N4STT5.pdb.gz
2	AFDB:A1L219	0.419	0.764	0.000	1046	0.422	0.795	A1L219.pdb.gz
3	AFDB:A7E2Y1	0.626	0.623	0.000	1983	0.396	0.393	A7E2Y1.pdb.gz	MYH7B_HUMAN Myosin-7B OS=Homo sapiens OX=9606 GN=MYH7B PE=1 SV=4
4	AFDB:B1AR69	0.641	0.651	0.000	1938	0.386	0.393	B1AR69.pdb.gz	B1AR69_MOUSE Myosin, heavy polypeptide 13, skeletal muscle OS=Mus musculus OX=10090 GN=Myh13 PE=1 SV=1
5	AFDB:B3DFS9	0.757	0.757	0.000	1974	0.807	0.806	B3DFS9.pdb.gz
6	AFDB:B8A568	0.677	0.689	0.000	1937	0.389	0.396	B8A568.pdb.gz	B8A568_DANRE Myosin, heavy polypeptide 1.1, skeletal muscle OS=Danio rerio OX=7955 GN=cb20 PE=1 SV=1
7	AFDB:B8JLS3	0.671	0.683	0.000	1936	0.385	0.392	B8JLS3.pdb.gz
8	AFDB:E7FD18	0.658	0.666	0.000	1945	0.394	0.399	E7FD18.pdb.gz
9	AFDB:F1QC64	0.685	0.769	0.000	1749	0.642	0.724	F1QC64.pdb.gz
10	AFDB:F1R3G4	0.707	0.700	0.000	1992	0.748	0.741	F1R3G4.pdb.gz	F1R3G4_DANRE Myosin, heavy chain 10, non-muscle OS=Danio rerio OX=7955 GN=myh10 PE=1 SV=1
11	PDB:7mf3B	0.368	0.789	1.997E-100	896	0.426	0.938	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
12	PDB:4pa0A	0.323	0.631	1.022E-78	974	0.196	0.396	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
13	PDB:4pa0B	0.324	0.671	1.086E-74	920	0.191	0.410	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
14	PDB:5tbyA	0.361	0.714	7.401E-72	954	0.235	0.485	5tbyA.pdb.gz
15	PDB:4p7hB	0.321	0.645	4.545E-71	952	0.192	0.398	4p7hB.pdb.gz
16	PDB:4anjA	0.335	0.651	4.220E-63	995	0.141	0.279	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
17	PDB:6ycxB	0.356	0.821	1.033E-58	817	0.116	0.279	6ycxB.pdb.gz	Full-length Plasmodium falciparum myosin A and essential light chain PfELC structures provide new anti-malarial targets.
18	PDB:7mf3G	0.082	0.384	3.672E-11	212	0.100	0.934	7mf3G.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
19	PDB:2eyqA	0.033	0.050	2.819E-1	1146	0.014	0.024	2eyqA.pdb.gz
20	PDB:7wrgA	0.048	0.097	2.819E-1	812	0.021	0.050	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JY53	1055	1922	0.343	0.352	A0A0G2JY53_RAT Myosin, heavy chain 15 OS=Rattus norvegicus OX=10116 GN=Myh15 PE=3 SV=2
2	A0A0G2K0F5	1298	1912	0.398	0.411	A0A0G2K0F5_RAT Myosin heavy chain 2 OS=Rattus norvegicus OX=10116 GN=Myh2 PE=1 SV=2
3	A0A0G2K1V4	1313	1937	0.398	0.405	A0A0G2K1V4_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=2
4	A0A0G2K484	1311	1939	0.395	0.402	A0A0G2K484_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=2
5	A0A0R4INI3	1289	1938	0.389	0.396	A0A0R4INI3_DANRE Slow myosin heavy chain 1 OS=Danio rerio OX=7955 GN=fb18g10 PE=1 SV=1
6	A0A1D8PN92	775	1948	0.246	0.249	A0A1D8PN92_CANAL Myosin 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MYO1 PE=3 SV=1
7	A2AQP0	1214	1941	0.394	0.400	MYH7B_MOUSE Myosin-7B OS=Mus musculus OX=10090 GN=Myh7b PE=3 SV=1
8	A6QLN6	3864	1972	0.969	0.969	A6QLN6_BOVIN MYH11 protein OS=Bos taurus OX=9913 GN=MYH11 PE=1 SV=1
9	A7E2Y1	1228	1983	0.397	0.394	MYH7B_HUMAN Myosin-7B OS=Homo sapiens OX=9606 GN=MYH7B PE=1 SV=4
10	B1AR69	1262	1938	0.385	0.392	B1AR69_MOUSE Myosin, heavy polypeptide 13, skeletal muscle OS=Mus musculus OX=10090 GN=Myh13 PE=1 SV=1
11	B6IDE1	1314	1939	0.393	0.400	B6IDE1_DANRE Slow myosin heavy chain 2 OS=Danio rerio OX=7955 GN=MYH7 PE=1 SV=1
12	B6RK61	1226	1941	0.396	0.402	B6RK61_RAT Myosin heavy chain 7B OS=Rattus norvegicus OX=10116 GN=Myh7b PE=2 SV=1
13	B8A568	1286	1937	0.393	0.400	B8A568_DANRE Myosin, heavy polypeptide 1.1, skeletal muscle OS=Danio rerio OX=7955 GN=cb20 PE=1 SV=1
14	F1LMU0	1304	1939	0.394	0.400	F1LMU0_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh4 PE=1 SV=1
15	F1LRV9	1315	1943	0.399	0.405	F1LRV9_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=3
16	F1QZW1	1303	1938	0.396	0.402	F1QZW1_DANRE Myosin heavy chain 7 OS=Danio rerio OX=7955 GN=mg:cb02g011 PE=1 SV=1
17	F1R3G4	2921	1992	0.743	0.736	F1R3G4_DANRE Myosin, heavy chain 10, non-muscle OS=Danio rerio OX=7955 GN=myh10 PE=1 SV=1
18	F7F0L5	1193	1929	0.390	0.399	F7F0L5_RAT Myosin heavy chain 7B OS=Rattus norvegicus OX=10116 GN=Myh7b PE=3 SV=1
19	G3UW82	1309	1942	0.399	0.405	G3UW82_MOUSE Myosin, heavy polypeptide 2, skeletal muscle, adult OS=Mus musculus OX=10090 GN=Myh2 PE=1 SV=1
20	G3V6E1	1310	1942	0.400	0.406	G3V6E1_RAT Myosin heavy chain 2 OS=Rattus norvegicus OX=10116 GN=Myh2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13401 AAA_22	2.7e+02	13.3	AAA domain
2	PF11559 ADIP	14	17.2	Afadin- and alpha -actinin-Binding
3	PF08614 ATG16	7.1	18.3	Autophagy protein 16 (ATG16)
4	PF16516 CC2-LZ	0.43	22.3	Leucine zipper of domain CC2 of NEMO, NF-kappa-B essential modulator
5	PF19220 Crescentin	1.2	19.8	Crescentin protein
6	PF20492 ERM_helical	5.7	18.5	Ezrin/radixin/moesin, alpha-helical domain
7	PF00612 IQ	3.4	18.7	IQ calmodulin-binding motif
8	PF00063 Myosin_head	0	1023.1	Myosin head (motor domain)
9	PF02736 Myosin_N	3.1e-13	60.5	Myosin N-terminal SH3-like domain
10	PF01576 Myosin_tail_1	0	1706.9	Myosin tail

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379616

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000279022	0.989	Myosin regulatory light polypeptide 9
2	9606.ENSP00000353452	0.982	Myosin light chain kinase, smooth muscle
3	9606.ENSP00000463559	0.978	Myosin regulatory light chain 12B
4	9606.ENSP00000217652	0.974	Myosin regulatory light chain 12A
5	9606.ENSP00000402373	0.974	Actin, aortic smooth muscle
6	9606.ENSP00000450385	0.966	Myosin light chain 6B
7	9606.ENSP00000307280	0.958	Myosin light chain 1/3, skeletal muscle isoform
8	9606.ENSP00000386857	0.955	Actin, gamma-enteric smooth muscle
9	9606.ENSP00000446955	0.954	Myosin light polypeptide 6
10	9606.ENSP00000228841	0.949	Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
11	9606.ENSP00000476755	0.949	Protein phosphatase 1 regulatory subunit 12B
12	9606.ENSP00000400175	0.945	Transforming protein RhoA
13	9606.ENSP00000389168	0.942	Protein phosphatase 1 regulatory subunit 12A
14	9606.ENSP00000349960	0.940	Actin, cytoplasmic 1
15	9606.ENSP00000376306	0.939	Citron Rho-interacting kinase
16	9606.ENSP00000470298	0.939	Myosin-14
17	9606.ENSP00000382697	0.936	Rho-associated protein kinase 1
18	9606.ENSP00000354826	0.934	Caldesmon
19	9606.ENSP00000356257	0.932	Leiomodin-1
20	9606.ENSP00000383023	0.932	Myosin light chain 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0003774	0.970	cytoskeletal motor activity
GO:0005515	0.970	protein binding
GO:0008092	0.959	cytoskeletal protein binding
GO:0000146	0.958	microfilament motor activity
GO:0003779	0.915	actin binding
GO:0008307	0.900	structural constituent of muscle
GO:0042802	0.892	identical protein binding
GO:0044877	0.654	protein-containing complex binding
GO:0019899	0.621	enzyme binding
GO:0043531	0.574	ADP binding
GO:0051015	0.397	actin filament binding
GO:0019901	0.315	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0032501	0.981	multicellular organismal process
GO:0048856	0.938	anatomical structure development
GO:0071840	0.927	cellular component organization or biogenesis
GO:0065007	0.922	biological regulation
GO:0030029	0.917	actin filament-based process
GO:0050789	0.907	regulation of biological process
GO:0016043	0.902	cellular component organization
GO:0007275	0.882	multicellular organism development
GO:0050794	0.851	regulation of cellular process
GO:0006996	0.836	organelle organization
GO:0048731	0.810	system development
GO:0009653	0.807	anatomical structure morphogenesis
GO:0007010	0.800	cytoskeleton organization
GO:0022607	0.714	cellular component assembly
GO:0048513	0.704	animal organ development
GO:0097435	0.685	supramolecular fiber organization
GO:0050896	0.677	response to stimulus
GO:0003008	0.619	system process
GO:0048869	0.617	cellular developmental process
GO:0030154	0.609	cell differentiation
GO:0030036	0.596	actin cytoskeleton organization
GO:0061061	0.590	muscle structure development
GO:0051716	0.375	cellular response to stimulus
GO:0048518	0.334	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0032991	0.998	protein-containing complex
GO:0099512	0.997	supramolecular fiber
GO:0015629	0.997	actin cytoskeleton
GO:0043227	0.996	membrane-bounded organelle
GO:0005829	0.989	cytosol
GO:0016460	0.976	myosin II complex
GO:0043292	0.958	contractile fiber
GO:0043231	0.931	intracellular membrane-bounded organelle
GO:0016020	0.913	membrane
GO:0031982	0.902	vesicle
GO:0071944	0.895	cell periphery
GO:0005576	0.889	extracellular region
GO:0005859	0.877	muscle myosin complex
GO:0005615	0.828	extracellular space
GO:0070062	0.785	extracellular exosome
GO:0005886	0.772	plasma membrane
GO:0005634	0.741	nucleus
GO:0012505	0.667	endomembrane system
GO:0031974	0.488	membrane-enclosed lumen
GO:0030054	0.481	cell junction
GO:0070013	0.479	intracellular organelle lumen
GO:0031981	0.467	nuclear lumen
GO:0005654	0.435	nucleoplasm
GO:0097708	0.337	intracellular vesicle
GO:0031410	0.334	cytoplasmic vesicle
GO:0070161	0.331	anchoring junction
GO:0042641	0.328	actomyosin
GO:0097517	0.300	contractile actin filament bundle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.8	0.958	myosin ATPase.

[back to server]