StarFunc result for job id P35813

User Input

>input (382 residues)
MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYD
GHAGSQVAKYCCEHLLDHITNNQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKH
GADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGG
SVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDG
IWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPE
AVKKEAELDKYLECRVEEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEA
VYNRLNPYKNDDTDSTSTDDMW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R6A5	0.991	0.991	5.515E-79	382	1.000	1.000	A0A024R6A5.pdb.gz
2	PDB:1a6qA	0.949	0.998	5.336E-72	363	0.950	1.000	1a6qA.pdb.gz	Crystal structure of the protein serine/threonine phosphatase 2C at 2.0 A resolution.
3	AFDB:O75688	0.981	0.783	9.510E-66	479	0.762	0.608	O75688.pdb.gz	PPM1B_HUMAN Protein phosphatase 1B OS=Homo sapiens OX=9606 GN=PPM1B PE=1 SV=1
4	AFDB:Q5U386	0.958	0.958	3.067E-64	382	0.738	0.738	Q5U386.pdb.gz	Q5U386_DANRE Protein phosphatase 1A, magnesium dependent, alpha OS=Danio rerio OX=7955 GN=ppm1a PE=1 SV=1
5	AFDB:Q961C5	0.908	0.928	2.401E-50	374	0.508	0.519	Q961C5.pdb.gz	Q961C5_DROME Alphabet, isoform E OS=Drosophila melanogaster OX=7227 GN=alph PE=1 SV=1
6	AFDB:Q09172	0.715	0.737	1.485E-34	370	0.340	0.351	Q09172.pdb.gz	PP2C2_SCHPO Protein phosphatase 2C homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ptc2 PE=3 SV=1
7	AFDB:Q381U4	0.695	0.620	4.817E-34	429	0.291	0.259	Q381U4.pdb.gz	Q381U4_TRYB2 Protein phosphatase 2C, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.6540 PE=4 SV=1
8	AFDB:P49596	0.706	0.756	1.321E-33	356	0.351	0.376	P49596.pdb.gz	PP2C2_CAEEL Probable protein phosphatase 2C T23F11.1 OS=Caenorhabditis elegans OX=6239 GN=ppm-2 PE=3 SV=2
9	AFDB:O81716	0.686	0.737	3.808E-32	355	0.317	0.341	O81716.pdb.gz	P2C21_ARATH Probable protein phosphatase 2C 21 OS=Arabidopsis thaliana OX=3702 GN=PPC4-2 PE=1 SV=1
10	AFDB:Q09173	0.698	0.646	6.668E-32	414	0.306	0.283	Q09173.pdb.gz	PP2C3_SCHPO Protein phosphatase 2C homolog 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ptc3 PE=3 SV=1
11	AFDB:Q38BA8	0.702	0.909	2.558E-31	293	0.298	0.389	Q38BA8.pdb.gz	Q38BA8_TRYB2 Protein phosphatase 2C-like, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2270 PE=4 SV=1
12	PDB:4oicB	0.590	0.734	4.822E-23	305	0.272	0.341	4oicB.pdb.gz	Identification and characterization of ABA receptors in Oryza sativa
13	PDB:4jndA	0.631	0.593	5.642E-21	408	0.217	0.203	4jndA.pdb.gz	Structural insight into Caenorhabditis elegans sex-determining protein FEM-2.
14	PDB:7kprA	0.580	0.552	3.708E-16	403	0.207	0.196	7kprA.pdb.gz	Structural basis for the specificity of PPM1H phosphatase for Rab GTPases.
15	PDB:5nzzD	0.538	0.542	1.190E-13	379	0.141	0.142	5nzzD.pdb.gz	The TAB1-p38 alpha complex aggravates myocardial injury and can be targeted by small molecules.
16	PDB:2pk0A	0.503	0.745	2.191E-12	247	0.113	0.174	2pk0A.pdb.gz	Structure of Streptococcus agalactiae serine/threonine phosphatase. The subdomain conformation is coupled to the binding of a third metal ion
17	PDB:5d2uA	0.407	0.613	2.317E-12	240	0.139	0.221	5d2uA.pdb.gz	Structural and Biochemical Characterization of a Cyanobacterial PP2C Phosphatase Reveals Insights into Catalytic Mechanism and Substrate Recognition
18	PDB:6jkvA	0.422	0.662	6.719E-12	230	0.128	0.213	6jkvA.pdb.gz	Crystal structure of PppA from Pseudomonas aeruginosa, a key regulatory component of type VI secretion systems.
19	PDB:3w40A	0.413	0.723	6.215E-8	199	0.089	0.171	3w40A.pdb.gz	Structure of the RsbX phosphatase involved in the general stress response of Bacillus subtilis
20	PDB:6rreD	0.404	0.367	3.472E-4	427	0.141	0.126	6rreD.pdb.gz	Structural insight into the membrane targeting domain of the Legionella deAMPylase SidD.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C9JIR6	0.0	603	378	0.764	0.772	C9JIR6_HUMAN protein-serine/threonine phosphatase (Fragment) OS=Homo sapiens OX=9606 GN=PPM1B PE=1 SV=1
2	O75688	0.0	608	479	0.767	0.612	PPM1B_HUMAN Protein phosphatase 1B OS=Homo sapiens OX=9606 GN=PPM1B PE=1 SV=1
3	P20650	0.0	788	382	0.990	0.990	PPM1A_RAT Protein phosphatase 1A OS=Rattus norvegicus OX=10116 GN=Ppm1a PE=1 SV=1
4	P35813	0.0	798	382	1.000	1.000	PPM1A_HUMAN Protein phosphatase 1A OS=Homo sapiens OX=9606 GN=PPM1A PE=1 SV=1
5	P36993	0.0	606	390	0.759	0.744	PPM1B_MOUSE Protein phosphatase 1B OS=Mus musculus OX=10090 GN=Ppm1b PE=1 SV=1
6	P49443	0.0	784	382	0.982	0.982	PPM1A_MOUSE Protein phosphatase 1A OS=Mus musculus OX=10090 GN=Ppm1a PE=1 SV=1
7	Q5U386	0.0	591	382	0.746	0.746	Q5U386_DANRE Protein phosphatase 1A, magnesium dependent, alpha OS=Danio rerio OX=7955 GN=ppm1a PE=1 SV=1
8	E9PKB5	2.07e-139	396	187	0.490	1.000	E9PKB5_HUMAN Protein phosphatase, Mg2+/Mn2+ dependent 1A (Fragment) OS=Homo sapiens OX=9606 GN=PPM1A PE=1 SV=1
9	Q8IMK7	1.31e-128	376	371	0.510	0.526	Q8IMK7_DROME Alphabet, isoform B OS=Drosophila melanogaster OX=7227 GN=alph PE=1 SV=1
10	Q9VAK1	1.33e-128	375	368	0.510	0.530	Q9VAK1_DROME Alphabet, isoform A OS=Drosophila melanogaster OX=7227 GN=alph PE=1 SV=1
11	Q961C5	1.73e-128	375	374	0.510	0.521	Q961C5_DROME Alphabet, isoform E OS=Drosophila melanogaster OX=7227 GN=alph PE=1 SV=1
12	A0A0B4K7Q3	2.13e-121	356	332	0.466	0.536	A0A0B4K7Q3_DROME Alphabet, isoform F OS=Drosophila melanogaster OX=7227 GN=alph PE=1 SV=1
13	E9PJN3	1.09e-107	314	148	0.387	1.000	E9PJN3_HUMAN Protein phosphatase, Mg2+/Mn2+ dependent 1A (Fragment) OS=Homo sapiens OX=9606 GN=PPM1A PE=1 SV=1
14	P49596	1.98e-65	213	356	0.332	0.357	PP2C2_CAEEL Probable protein phosphatase 2C T23F11.1 OS=Caenorhabditis elegans OX=6239 GN=ppm-2 PE=3 SV=2
15	O81716	2.68e-64	211	355	0.319	0.344	P2C21_ARATH Probable protein phosphatase 2C 21 OS=Arabidopsis thaliana OX=3702 GN=PPC4-2 PE=1 SV=1
16	Q09172	5.57e-64	210	370	0.319	0.330	PP2C2_SCHPO Protein phosphatase 2C homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ptc2 PE=3 SV=1
17	Q381U4	2.72e-61	205	429	0.298	0.266	Q381U4_TRYB2 Protein phosphatase 2C, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.6540 PE=4 SV=1
18	Q38BA8	2.97e-61	201	293	0.304	0.396	Q38BA8_TRYB2 Protein phosphatase 2C-like, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2270 PE=4 SV=1
19	Q9SZ53	2.98e-61	202	357	0.319	0.342	P2C60_ARATH Probable protein phosphatase 2C 60 OS=Arabidopsis thaliana OX=3702 GN=At4g31860 PE=2 SV=1
20	Q09173	4.50e-60	201	414	0.304	0.280	PP2C3_SCHPO Protein phosphatase 2C homolog 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ptc3 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00481 PP2C	5.8e-87	303.1	Protein phosphatase 2C
2	PF07830 PP2C_C	2.3e-28	109.8	Protein serine/threonine phosphatase 2C, C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9541.XP_005561470.1

Rank	PPI partner	STRING score	Description
1	9541.XP_005582984.1	0.882	Belongs to the protein kinase superfamily.
2	9541.XP_005583202.1	0.877	Dual specificity mitogen-activated protein kinase kinase 3 isoform X1
3	9541.XP_005584859.1	0.877	Dual specificity mitogen-activated protein kinase kinase 6 isoform X1
4	9541.XP_005587861.1	0.870	Dual specificity mitogen-activated protein kinase kinase 7 isoform X1
5	9541.XP_005586813.1	0.839	Mothers against decapentaplegic homolog 2 isoform X1
6	9541.XP_005559930.1	0.789	Mothers against decapentaplegic homolog 3 isoform X1
7	9541.XP_005576044.1	0.718	Protein phosphatase 1B isoform X1
8	9541.XP_005586732.1	0.716	Mothers against decapentaplegic homolog 4 isoform X1
9	9541.XP_005545250.1	0.712	5'-AMP-activated protein kinase catalytic subunit alpha-2
10	9541.XP_005556844.1	0.712	5'-AMP-activated protein kinase catalytic subunit alpha-1 isoform X1
11	9541.XP_005565939.1	0.688	Uncharacterized protein
12	9541.XP_005556069.1	0.684	Mothers against decapentaplegic homolog 1 isoform X1
13	9541.XP_005557901.1	0.684	Mothers against decapentaplegic homolog 5 isoform X1
14	9541.XP_005572434.1	0.675	5'-AMP-activated protein kinase subunit beta-1 isoform X1
15	9541.XP_005585736.1	0.673	Mothers against decapentaplegic homolog
16	9541.XP_005542135.1	0.667	5'-AMP-activated protein kinase subunit beta-2 isoform X1
17	9541.XP_005559315.1	0.657	JNK-binding protein 1
18	9541.XP_005551275.1	0.655	5'-AMP-activated protein kinase subunit gamma-2 isoform X1
19	9541.XP_005570796.1	0.655	5'-AMP-activated protein kinase subunit gamma-1 isoform X1
20	9541.XP_005574373.1	0.655	5'-AMP-activated protein kinase subunit gamma-3 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004722	0.998	protein serine/threonine phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0090287	0.990	regulation of cellular response to growth factor stimulus
GO:0044237	0.986	cellular metabolic process
GO:0071704	0.984	organic substance metabolic process
GO:0023051	0.983	regulation of signaling
GO:0010646	0.983	regulation of cell communication
GO:0044238	0.975	primary metabolic process
GO:0090092	0.969	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0006807	0.944	nitrogen compound metabolic process
GO:0048523	0.919	negative regulation of cellular process
GO:0043170	0.917	macromolecule metabolic process
GO:1901564	0.913	organonitrogen compound metabolic process
GO:0036211	0.896	protein modification process
GO:0090101	0.895	negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0006796	0.887	phosphate-containing compound metabolic process
GO:0016311	0.818	dephosphorylation
GO:0050896	0.634	response to stimulus
GO:0019222	0.563	regulation of metabolic process
GO:0048518	0.533	positive regulation of biological process
GO:0006470	0.526	protein dephosphorylation
GO:0060255	0.461	regulation of macromolecule metabolic process
GO:0048522	0.417	positive regulation of cellular process
GO:0031323	0.391	regulation of cellular metabolic process
GO:0080090	0.381	regulation of primary metabolic process
GO:1902531	0.330	regulation of intracellular signal transduction
GO:0051171	0.323	regulation of nitrogen compound metabolic process
GO:0010468	0.308	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0043231	0.977	intracellular membrane-bounded organelle
GO:0016020	0.976	membrane
GO:0071944	0.959	cell periphery
GO:0031981	0.958	nuclear lumen
GO:0005886	0.934	plasma membrane
GO:0005654	0.855	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.16	0.998	protein-serine/threonine phosphatase.

[back to server]