StarFunc result for job id P35869

User Input

>input (848 residues)
MNSSSANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDV
INKLDKLSVLRLSVSYLRAKSFFDVALKSSPTERNGGQDNCRAANFREGLNLQEGEFLLQ
ALNGFVLVVTTDALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNP
SQCTESGQGIEEATGLPQTVVCYNPDQIPPENSPLMERCFICRLRCLLDNSSGFLAMNFQ
GKLKYLHGQKKKGKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPIGC
DAKGRIVLGYTEAELCTRGSGYQFIHAADMLYCAESHIRMIKTGESGMIVFRLLTKNNRW
TWVQSNARLLYKNGRPDYIIVTQRPLTDEEGTEHLRKRNTKLPFMFTTGEAVLYEATNPF
PAIMDPLPLRTKNGTSGKDSATTSTLSKDSLNPSSLLAAMMQQDESIYLYPASSTSSTAP
FENNFFNESMNECRNWQDNTAPMGNDTILKHEQIDQPQDVNSFAGGHPGLFQDSKNSDLY
SIMKNLGIDFEDIRHMQNEKFFRNDFSGEVDFRDIDLTDEILTYVQDSLSKSPFIPSDYQ
QQQSLALNSSCMVQEHLHLEQQQQHHQKQVVVEPQQQLCQKMKHMQVNGMFENWNSNQFV
PFNCPQQDPQQYNVFTDLHGISQEFPYKSEMDSMPYTQNFISCNQPVLPQHSKCTELDYP
MGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVSMYQCQPEPQH
THVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHHPSEARPFP
DLTSSGFL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P35869	1.000	1.000	0.000	848	1.000	1.000	P35869.pdb.gz	AHR_HUMAN Aryl hydrocarbon receptor OS=Homo sapiens OX=9606 GN=AHR PE=1 SV=2
2	AFDB:P41738	0.593	0.590	2.236E-101	853	0.729	0.725	P41738.pdb.gz	AHR_RAT Aryl hydrocarbon receptor OS=Rattus norvegicus OX=10116 GN=Ahr PE=1 SV=2
3	AFDB:F1NLX8	0.495	0.490	8.301E-93	858	0.664	0.656	F1NLX8.pdb.gz
4	AFDB:B3DJJ7	0.475	0.434	2.204E-71	940	0.453	0.409	B3DJJ7.pdb.gz
5	AFDB:E1JIM6	0.307	0.263	6.599E-44	1015	0.290	0.242	E1JIM6.pdb.gz	E1JIM6_DROME Spineless, isoform C OS=Drosophila melanogaster OX=7227 GN=ss PE=1 SV=2
6	AFDB:Q9W6J4	0.193	0.185	1.223E-27	893	0.179	0.170	Q9W6J4.pdb.gz
7	AFDB:Q8JIG3	0.182	0.183	1.293E-27	845	0.175	0.175	Q8JIG3.pdb.gz	Q8JIG3_DANRE BHLH-PAS transcription factor OS=Danio rerio OX=7955 GN=zfCLOCK2 PE=2 SV=1
8	AFDB:Q8QGQ6	0.191	0.187	4.407E-27	875	0.202	0.195	Q8QGQ6.pdb.gz	CLOCK_CHICK Circadian locomoter output cycles protein kaput OS=Gallus gallus OX=9031 GN=CLOCK PE=1 SV=2
9	AFDB:B3DH92	0.198	0.203	7.695E-27	820	0.183	0.189	B3DH92.pdb.gz	B3DH92_DANRE Clock circadian regulator b OS=Danio rerio OX=7955 GN=clock3 PE=2 SV=1
10	AFDB:Q91YB0	0.197	0.193	1.877E-26	865	0.188	0.184	Q91YB0.pdb.gz	CLOCK_NANGA Circadian locomoter output cycles protein kaput OS=Nannospalax galili OX=1026970 GN=Clock PE=1 SV=1
11	PDB:2wkpA	0.112	0.281	2.127E-4	320	0.021	0.056	2wkpA.pdb.gz	A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
12	PDB:7q3dB	0.060	0.094	2.763E-3	453	0.025	0.046	7q3dB.pdb.gz
13	PDB:7rzwB	0.129	0.126	2.763E-3	864	0.029	0.029	7rzwB.pdb.gz	Plant phytochrome B is an asymmetric dimer with unique signalling potential.
14	PDB:6jt0B	0.086	0.121	6.741E-3	576	0.034	0.050	6jt0B.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
15	PDB:6umzA	0.098	0.566	9.419E-3	127	0.013	0.087	6umzA.pdb.gz	Structural and spectroscopic characterization of photoactive yellow protein and photoswitchable fluorescent protein constructs containing heavy atoms.
16	PDB:7c8zA	0.050	0.092	1.529E-1	383	0.033	0.073	7c8zA.pdb.gz	Structural and Biochemical Analysis Reveals a Distinct Catalytic Site of Salicylate 5-Monooxygenase NagGH from Rieske Dioxygenases.
17	PDB:3c6kD	0.042	0.085	1.617E-1	348	0.012	0.029	3c6kD.pdb.gz	Crystal structure of human spermine synthase: implications of substrate binding and catalytic mechanism.
18	PDB:2w1tA	0.082	0.328	1.911E-1	175	0.019	0.091	2w1tA.pdb.gz
19	PDB:5a1uE	0.060	0.061	2.136E-1	824	0.022	0.023	5a1uE.pdb.gz
20	PDB:7q05E	0.054	0.085	2.259E-1	409	0.033	0.068	7q05E.pdb.gz	Biochemical and structural characterization of an aromatic ring-hydroxylating dioxygenase for terephthalic acid catabolism.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P30561	0.0	1211	848	0.716	0.716	AHR_MOUSE Aryl hydrocarbon receptor OS=Mus musculus OX=10090 GN=Ahr PE=1 SV=3
2	P35869	0.0	1774	848	1.000	1.000	AHR_HUMAN Aryl hydrocarbon receptor OS=Homo sapiens OX=9606 GN=AHR PE=1 SV=2
3	P41738	0.0	1236	853	0.724	0.720	AHR_RAT Aryl hydrocarbon receptor OS=Rattus norvegicus OX=10116 GN=Ahr PE=1 SV=2
4	Q4U3K9	0.0	639	940	0.415	0.374	Q4U3K9_DANRE Aryl hydrocarbon receptor OS=Danio rerio OX=7955 GN=si:dkey-159d6.1 PE=2 SV=1
5	Q8QGQ3	0.0	579	805	0.367	0.386	Q8QGQ3_DANRE Aryl hydrocarbon receptor type 1 OS=Danio rerio OX=7955 GN=ahr1 PE=2 SV=1
6	Q9I9E2	0.0	1043	858	0.658	0.650	Q9I9E2_CHICK Aryl hydrocarbon receptor OS=Gallus gallus OX=9031 GN=AHR1A PE=2 SV=1
7	Q9PTI7	0.0	1043	858	0.657	0.649	Q9PTI7_CHICK Aryl hydrocarbon receptor OS=Gallus gallus OX=9031 GN=AHR PE=2 SV=2
8	Q9YGV3	0.0	589	1027	0.364	0.301	Q9YGV3_DANRE Aryl hydrocarbon receptor OS=Danio rerio OX=7955 GN=AHR2 PE=2 SV=1
9	E1C4K6	4.55e-158	486	882	0.295	0.283	E1C4K6_CHICK Aryl hydrocarbon receptor 2 OS=Gallus gallus OX=9031 PE=2 SV=3
10	O61543	1.36e-113	369	884	0.229	0.219	O61543_DROME Ahr homolog spineless OS=Drosophila melanogaster OX=7227 GN=ss PE=2 SV=1
11	Q9VEV9	4.90e-113	367	884	0.228	0.218	Q9VEV9_DROME Spineless, isoform A OS=Drosophila melanogaster OX=7227 GN=ss PE=4 SV=1
12	E5L8C8	6.31e-113	364	756	0.222	0.249	E5L8C8_CHICK Aryl hydrocarbon receptor repressor OS=Gallus gallus OX=9031 GN=ahrr PE=2 SV=1
13	E1JIM6	6.53e-112	368	1015	0.228	0.190	E1JIM6_DROME Spineless, isoform C OS=Drosophila melanogaster OX=7227 GN=ss PE=1 SV=2
14	Q3U1U7	3.41e-93	310	701	0.203	0.245	AHRR_MOUSE Aryl hydrocarbon receptor repressor OS=Mus musculus OX=10090 GN=Ahrr PE=1 SV=1
15	A9YTQ3	1.03e-92	308	701	0.230	0.278	AHRR_HUMAN Aryl hydrocarbon receptor repressor OS=Homo sapiens OX=9606 GN=AHRR PE=1 SV=3
16	Q3T2L2	1.61e-89	296	573	0.180	0.267	Q3T2L2_DANRE Aryl hydrocarbon receptor repressor 2 OS=Danio rerio OX=7955 GN=ahrr2 PE=2 SV=1
17	Q3T2L3	5.78e-85	283	550	0.173	0.267	Q3T2L3_DANRE Aryl hydrocarbon receptor repressor 1 OS=Danio rerio OX=7955 GN=ahrr1 PE=2 SV=1
18	O44712	4.82e-73	253	602	0.189	0.266	AHR_CAEEL Aryl hydrocarbon receptor protein 1 OS=Caenorhabditis elegans OX=6239 GN=ahr-1 PE=1 SV=1
19	P05709	1.01e-38	156	697	0.131	0.159	SIM_DROME Protein single-minded OS=Drosophila melanogaster OX=7227 GN=sim PE=1 SV=3
20	D6RE68	5.07e-37	149	557	0.126	0.192	D6RE68_HUMAN Aryl hydrocarbon receptor repressor OS=Homo sapiens OX=9606 GN=AHRR PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00010 HLH	0.01	27.2	Helix-loop-helix DNA-binding domain
2	PF00989 PAS	4.9e-14	63.7	PAS fold
3	PF14598 PAS_11	1.4e-07	42.9	PAS domain
4	PF08447 PAS_3	1.3e-16	72.0	PAS fold
5	PF08448 PAS_4	2.8	19.6	PAS fold
6	PF13426 PAS_9	7.7	18.2	PAS domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000242057

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000279146	0.999	AH receptor-interacting protein
2	9606.ENSP00000335153	0.999	Heat shock protein HSP 90-alpha
3	9606.ENSP00000351407	0.998	Aryl hydrocarbon receptor nuclear translocator
4	9606.ENSP00000405330	0.998	Estrogen receptor
5	9606.ENSP00000369050	0.993	Cytochrome P450 1A1
6	9606.ENSP00000327048	0.992	Transcription factor Maf
7	9606.ENSP00000354394	0.990	Signal transducer and activator of transcription 1-alpha/beta
8	9606.ENSP00000221452	0.989	Transcription factor RelB
9	9606.ENSP00000384273	0.989	Transcription factor p65
10	9606.ENSP00000419923	0.971	Krueppel-like factor 6
11	9606.ENSP00000362680	0.967	Proto-oncogene tyrosine-protein kinase Src
12	9606.ENSP00000482075	0.965	Prostaglandin E synthase 3
13	9606.ENSP00000307479	0.959	Aryl hydrocarbon receptor nuclear translocator 2
14	9606.ENSP00000360609	0.955	Heat shock protein HSP 90-beta
15	9606.ENSP00000384109	0.929	Cullin-4B
16	9606.ENSP00000478561	0.924	Cytochrome P450 1B1
17	9606.ENSP00000363822	0.908	Androgen receptor
18	9606.ENSP00000311513	0.904	Remodeling and spacing factor 1
19	9606.ENSP00000383063	0.901	Nuclear receptor-interacting protein 1
20	9606.ENSP00000384018	0.895	Nuclear receptor corepressor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140297	1.000	DNA-binding transcription factor binding
GO:0046982	1.000	protein heterodimerization activity
GO:0000976	1.000	transcription cis-regulatory region binding
GO:0004879	0.999	nuclear receptor activity
GO:0000987	0.950	cis-regulatory region sequence-specific DNA binding
GO:0061629	0.789	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0031072	0.752	heat shock protein binding
GO:0051879	0.738	Hsp90 protein binding
GO:0140296	0.717	general transcription initiation factor binding
GO:0001091	0.710	RNA polymerase II general transcription initiation factor binding
GO:0001221	0.692	transcription coregulator binding
GO:0044877	0.679	protein-containing complex binding
GO:0060090	0.655	molecular adaptor activity
GO:0017025	0.622	TBP-class protein binding
GO:0001223	0.618	transcription coactivator binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.998	response to stimulus
GO:0080090	0.996	regulation of primary metabolic process
GO:0051171	0.996	regulation of nitrogen compound metabolic process
GO:0031323	0.996	regulation of cellular metabolic process
GO:0010468	0.995	regulation of gene expression
GO:0006355	0.993	regulation of DNA-templated transcription
GO:0009987	0.989	cellular process
GO:0048522	0.988	positive regulation of cellular process
GO:0042221	0.963	response to chemical
GO:0051716	0.962	cellular response to stimulus
GO:0010604	0.947	positive regulation of macromolecule metabolic process
GO:0051173	0.927	positive regulation of nitrogen compound metabolic process
GO:0031325	0.905	positive regulation of cellular metabolic process
GO:0045893	0.897	positive regulation of DNA-templated transcription
GO:0070887	0.893	cellular response to chemical stimulus
GO:0010033	0.831	response to organic substance
GO:0009410	0.781	response to xenobiotic stimulus
GO:0006357	0.718	regulation of transcription by RNA polymerase II
GO:0071310	0.701	cellular response to organic substance
GO:0014070	0.678	response to organic cyclic compound
GO:0048519	0.502	negative regulation of biological process
GO:0045944	0.442	positive regulation of transcription by RNA polymerase II
GO:0008152	0.409	metabolic process
GO:0044237	0.338	cellular metabolic process
GO:0071704	0.307	organic substance metabolic process
GO:0048523	0.305	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005667	0.996	transcription regulator complex
GO:0005654	0.995	nucleoplasm
GO:0005829	0.993	cytosol
GO:0043235	0.885	receptor complex
GO:0140535	0.861	intracellular protein-containing complex
GO:0140513	0.549	nuclear protein-containing complex
GO:0034751	0.489	aryl hydrocarbon receptor complex
GO:0034752	0.318	cytosolic aryl hydrocarbon receptor complex
GO:0034753	0.318	nuclear aryl hydrocarbon receptor complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]