StarFunc result for job id P35900

User Input

>input (424 residues)
MDFSRRSFHRSLSSSLQAPVVSTVGMQRLGTTPSVYGGAGGRGIRISNSRHTVNYGSDLT
GGGDLFVGNEKMAMQNLNDRLASYLEKVRTLEQSNSKLEVQIKQWYETNAPRAGRDYSAY
YRQIEELRSQIKDAQLQNARCVLQIDNAKLAAEDFRLKYETERGIRLTVEADLQGLNKVF
DDLTLHKTDLEIQIEELNKDLALLKKEHQEEVDGLHKHLGNTVNVEVDAAPGLNLGVIMN
EMRQKYEVMAQKNLQEAKEQFERQTAVLQQQVTVNTEELKGTEVQLTELRRTSQSLEIEL
QSHLSMKESLEHTLEETKARYSSQLANLQSLLSSLEAQLMQIRSNMERQNNEYHILLDIK
TRLEQEIATYRRLLEGEDVKTTEYQLSTLEERDIKKTRKIKTVVQEVVDGKVVSSEVKEV
EENI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P35900	1.000	1.000	9.283E-56	424	1.000	1.000	P35900.pdb.gz	K1C20_HUMAN Keratin, type I cytoskeletal 20 OS=Homo sapiens OX=9606 GN=KRT20 PE=1 SV=1
2	AFDB:Q9D312	0.681	0.670	6.258E-44	431	0.797	0.784	Q9D312.pdb.gz	K1C20_MOUSE Keratin, type I cytoskeletal 20 OS=Mus musculus OX=10090 GN=Krt20 PE=1 SV=1
3	AFDB:Q6PVZ1	0.461	0.424	4.624E-28	467	0.502	0.456	Q6PVZ1.pdb.gz	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1
4	AFDB:Q6IFU8	0.430	0.422	2.816E-27	433	0.488	0.478	Q6IFU8.pdb.gz	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
5	AFDB:Q9PWD8	0.577	0.570	2.563E-26	429	0.483	0.478	Q9PWD8.pdb.gz	Q9PWD8_DANRE Type I cytokeratin OS=Danio rerio OX=7955 GN=wu:fa03a08 PE=1 SV=1
6	AFDB:Q1LXJ1	0.533	0.534	1.785E-25	423	0.460	0.461	Q1LXJ1.pdb.gz	Q1LXJ1_DANRE Keratin 17 OS=Danio rerio OX=7955 GN=si:dkeyp-113d7.7 PE=1 SV=1
7	AFDB:P02533	0.600	0.545	3.260E-25	472	0.512	0.460	P02533.pdb.gz	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4
8	AFDB:Q6IFV1	0.516	0.461	6.365E-25	485	0.491	0.429	Q6IFV1.pdb.gz	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1
9	AFDB:Q99456	0.454	0.398	6.365E-25	494	0.479	0.411	Q99456.pdb.gz	K1C12_HUMAN Keratin, type I cytoskeletal 12 OS=Homo sapiens OX=9606 GN=KRT12 PE=1 SV=1
10	AFDB:P19012	0.509	0.477	1.017E-24	456	0.476	0.443	P19012.pdb.gz	K1C15_HUMAN Keratin, type I cytoskeletal 15 OS=Homo sapiens OX=9606 GN=KRT15 PE=1 SV=3
11	PDB:6fhmA	0.054	0.104	9.144E-1	193	0.019	0.041	6fhmA.pdb.gz
12	PDB:5ondA	0.050	0.139	1.786	135	0.014	0.044	5ondA.pdb.gz	The universally-conserved transcription factor RfaH is recruited to a hairpin structure of the non-template DNA strand.
13	PDB:6w6vG	0.041	0.116	3.050	126	0.019	0.063	6w6vG.pdb.gz	Cryo-EM structure of catalytic ribonucleoprotein complex RNase MRP.
14	PDB:5g06J	0.055	0.025	3.261	993	0.009	0.004	5g06J.pdb.gz
15	PDB:5tthA	0.077	0.054	3.261	671	0.035	0.022	5tthA.pdb.gz	Symmetry broken and rebroken during the ATP hydrolysis cycle of the mitochondrial Hsp90 TRAP1.
16	PDB:6sh3A	0.060	0.068	3.487	376	0.028	0.032	6sh3A.pdb.gz	Structure of the Bcs1 AAA-ATPase suggests an airlock-like translocation mechanism for folded proteins.
17	PDB:1u6zB	0.034	0.029	3.728	500	0.012	0.010	1u6zB.pdb.gz
18	PDB:3k8aB	0.049	0.165	3.986	103	0.007	0.029	3k8aB.pdb.gz
19	PDB:5fywU	0.083	0.251	3.986	92	0.021	0.098	5fywU.pdb.gz	Transcription Initiation Complex Structures Elucidate DNA Opening
20	PDB:4xo1A	0.058	0.320	4.262	60	0.021	0.150	4xo1A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P35900	0.0	860	424	1.000	1.000	K1C20_HUMAN Keratin, type I cytoskeletal 20 OS=Homo sapiens OX=9606 GN=KRT20 PE=1 SV=1
2	Q9D312	0.0	673	431	0.797	0.784	K1C20_MOUSE Keratin, type I cytoskeletal 20 OS=Mus musculus OX=10090 GN=Krt20 PE=1 SV=1
3	Q6IFU8	3.87e-133	391	433	0.493	0.483	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
4	Q04695	1.04e-132	390	432	0.462	0.454	K1C17_HUMAN Keratin, type I cytoskeletal 17 OS=Homo sapiens OX=9606 GN=KRT17 PE=1 SV=2
5	Q9QWL7	3.06e-132	389	433	0.474	0.464	K1C17_MOUSE Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3
6	Q6PVZ1	8.40e-132	389	467	0.465	0.422	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1
7	P02533	2.35e-128	380	472	0.460	0.413	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4
8	Q6IFV1	1.81e-126	376	485	0.455	0.398	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1
9	Q61781	7.65e-125	372	484	0.450	0.395	K1C14_MOUSE Keratin, type I cytoskeletal 14 OS=Mus musculus OX=10090 GN=Krt14 PE=1 SV=2
10	B1AQ75	2.44e-123	368	473	0.469	0.421	KRT36_MOUSE Keratin, type I cuticular Ha6 OS=Mus musculus OX=10090 GN=Krt36 PE=1 SV=1
11	K7ERE3	1.95e-122	363	415	0.432	0.441	K7ERE3_HUMAN Keratin 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=1
12	P13646	3.16e-122	364	458	0.434	0.402	K1C13_HUMAN Keratin, type I cytoskeletal 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=4
13	P08727	3.74e-122	362	400	0.420	0.445	K1C19_HUMAN Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4
14	A1A4E9	2.49e-121	362	458	0.432	0.400	A1A4E9_HUMAN Keratin 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=1
15	P19001	4.56e-121	359	403	0.410	0.432	K1C19_MOUSE Keratin, type I cytoskeletal 19 OS=Mus musculus OX=10090 GN=Krt19 PE=1 SV=1
16	Q6IFV4	7.07e-121	360	438	0.434	0.420	K1C13_RAT Keratin, type I cytoskeletal 13 OS=Rattus norvegicus OX=10116 GN=Krt13 PE=3 SV=1
17	P08730	1.01e-120	360	437	0.432	0.419	K1C13_MOUSE Keratin, type I cytoskeletal 13 OS=Mus musculus OX=10090 GN=Krt13 PE=1 SV=2
18	P08779	3.69e-120	359	473	0.429	0.385	K1C16_HUMAN Keratin, type I cytoskeletal 16 OS=Homo sapiens OX=9606 GN=KRT16 PE=1 SV=4
19	Q64291	2.33e-119	358	487	0.446	0.388	K1C12_MOUSE Keratin, type I cytoskeletal 12 OS=Mus musculus OX=10090 GN=Krt12 PE=1 SV=2
20	Q63279	2.63e-119	355	403	0.410	0.432	K1C19_RAT Keratin, type I cytoskeletal 19 OS=Rattus norvegicus OX=10116 GN=Krt19 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04108 ATG17_like	34	15.3	Autophagy protein ATG17-like domain
2	PF00038 Filament	1.7e-102	354.8	Intermediate filament protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000167588

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370408	0.871	Homeobox protein CDX-2
2	9606.ENSP00000221992	0.837	Carcinoembryonic antigen-related cell adhesion molecule 5
3	9606.ENSP00000346879	0.770	Homeobox protein Nkx-2.1
4	9606.ENSP00000263233	0.754	Synaptophysin
5	9606.ENSP00000291009	0.710	Prolactin induced protein
6	9606.ENSP00000446007	0.694	Vimentin
7	9606.ENSP00000216492	0.682	Chromogranin-A
8	9606.ENSP00000437402	0.681	Gamma-enolase
9	9606.ENSP00000216211	0.668	Uroplakin-3a
10	9606.ENSP00000253719	0.658	Napsin-A
11	9606.ENSP00000264031	0.607	Uroplakin-2
12	9606.ENSP00000307508	0.602	Calretinin
13	9606.ENSP00000266674	0.600	Leucine-rich repeat-containing G-protein coupled receptor 5
14	9606.ENSP00000480132	0.599	Neural cell adhesion molecule 1
15	9606.ENSP00000346158	0.593	Regenerating islet-derived protein 4
16	9606.ENSP00000485659	0.582	Mucin-5AC
17	9606.ENSP00000478942	0.571	Uroplakin-1a
18	9606.ENSP00000325120	0.564	Progesterone receptor
19	9606.ENSP00000269305	0.561	Cellular tumor antigen p53
20	9606.ENSP00000263334	0.560	Paired box protein Pax-8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.453	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0045103	0.953	intermediate filament-based process
GO:0065007	0.817	biological regulation
GO:0050789	0.782	regulation of biological process
GO:0050794	0.760	regulation of cellular process
GO:0071840	0.750	cellular component organization or biogenesis
GO:0016043	0.657	cellular component organization
GO:0045104	0.543	intermediate filament cytoskeleton organization
GO:0050896	0.494	response to stimulus
GO:0045109	0.489	intermediate filament organization
GO:0032502	0.485	developmental process
GO:0048856	0.470	anatomical structure development
GO:0051716	0.353	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.990	cytosol
GO:0043226	0.982	organelle
GO:0005576	0.948	extracellular region
GO:0043229	0.920	intracellular organelle
GO:0031982	0.903	vesicle
GO:0005615	0.838	extracellular space
GO:0043231	0.789	intracellular membrane-bounded organelle
GO:0043232	0.765	intracellular non-membrane-bounded organelle
GO:0016020	0.620	membrane
GO:0005856	0.563	cytoskeleton
GO:0099080	0.437	supramolecular complex
GO:0045111	0.435	intermediate filament cytoskeleton
GO:0071944	0.418	cell periphery
GO:0070062	0.386	extracellular exosome
GO:0099512	0.347	supramolecular fiber
GO:0005886	0.325	plasma membrane
GO:0099513	0.318	polymeric cytoskeletal fiber

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]