StarFunc result for job id P35908

User Input

>input (639 residues)
MSCQISCKSRGRGGGGGGFRGFSSGSAVVSGGSRRSTSSFSCLSRHGGGGGGFGGGGFGS
RSLVGLGGTKSISISVAGGGGGFGAAGGFGGRGGGFGGGSSFGGGSGFSGGGFGGGGFGG
GRFGGFGGPGGVGGLGGPGGFGPGGYPGGIHEVSVNQSLLQPLNVKVDPEIQNVKAQERE
QIKTLNNKFASFIDKVRFLEQQNQVLQTKWELLQQMNVGTRPINLEPIFQGYIDSLKRYL
DGLTAERTSQNSELNNMQDLVEDYKKKYEDEINKRTAAENDFVTLKKDVDNAYMIKVELQ
SKVDLLNQEIEFLKVLYDAEISQIHQSVTDTNVILSMDNSRNLDLDSIIAEVKAQYEEIA
QRSKEEAEALYHSKYEELQVTVGRHGDSLKEIKIEISELNRVIQRLQGEIAHVKKQCKNV
QDAIADAEQRGEHALKDARNKLNDLEEALQQAKEDLARLLRDYQELMNVKLALDVEIATY
RKLLEGEECRMSGDLSSNVTVSVTSSTISSNVASKAAFGGSGGRGSSSGGGYSSGSSSYG
SGGRQSGSRGGSGGGGSISGGGYGSGGGSGGRYGSGGGSKGGSISGGGYGSGGGKHSSGG
GSRGGSSSGGGYGSGGGGSSSVKGSSGEAFGSSVTFSFR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P35908	1.000	1.000	1.366E-75	639	1.000	1.000	P35908.pdb.gz	K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens OX=9606 GN=KRT2 PE=1 SV=2
2	AFDB:Q3TTY5	0.459	0.422	2.798E-47	707	0.803	0.726	Q3TTY5.pdb.gz	K22E_MOUSE Keratin, type II cytoskeletal 2 epidermal OS=Mus musculus OX=10090 GN=Krt2 PE=1 SV=1
3	AFDB:P04264	0.263	0.262	2.823E-37	644	0.643	0.638	P04264.pdb.gz	K2C1_HUMAN Keratin, type II cytoskeletal 1 OS=Homo sapiens OX=9606 GN=KRT1 PE=1 SV=6
4	AFDB:Q01546	0.380	0.381	6.966E-37	638	0.624	0.625	Q01546.pdb.gz	K22O_HUMAN Keratin, type II cytoskeletal 2 oral OS=Homo sapiens OX=9606 GN=KRT76 PE=1 SV=2
5	AFDB:P04104	0.405	0.406	8.352E-36	637	0.613	0.615	P04104.pdb.gz	K2C1_MOUSE Keratin, type II cytoskeletal 1 OS=Mus musculus OX=10090 GN=Krt1 PE=1 SV=4
6	AFDB:Q0IIN1	0.284	0.309	1.312E-35	578	0.546	0.604	Q0IIN1.pdb.gz	Q0IIN1_HUMAN Keratin 77 OS=Homo sapiens OX=9606 GN=KRT77 PE=1 SV=1
7	AFDB:Q6IFZ6	0.458	0.502	2.222E-35	572	0.557	0.622	Q6IFZ6.pdb.gz	K2C1B_MOUSE Keratin, type II cytoskeletal 1b OS=Mus musculus OX=10090 GN=Krt77 PE=1 SV=1
8	AFDB:P13647	0.250	0.267	2.785E-35	590	0.565	0.612	P13647.pdb.gz	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
9	AFDB:P02538	0.259	0.290	4.718E-35	564	0.543	0.615	P02538.pdb.gz	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3
10	AFDB:P19013	0.450	0.536	2.126E-34	520	0.507	0.623	P19013.pdb.gz	K2C4_HUMAN Keratin, type II cytoskeletal 4 OS=Homo sapiens OX=9606 GN=KRT4 PE=1 SV=5
11	PDB:5wlcST	0.073	0.077	2.190	599	0.036	0.038	5wlcST.pdb.gz	The complete structure of the small-subunit processome.
12	PDB:7d5sRN	0.073	0.076	3.191	607	0.036	0.038	7d5sRN.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
13	PDB:7ung3	0.124	0.235	7.874	297	0.081	0.175	7ung3.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
14	PDB:6u424R	0.135	0.214	9.869	366	0.074	0.128	6u424R.pdb.gz	Structure of the Decorated Ciliary Doublet Microtubule.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	O95678	553	551	0.505	0.586	K2C75_HUMAN Keratin, type II cytoskeletal 75 OS=Homo sapiens OX=9606 GN=KRT75 PE=1 SV=2
2	P02538	557	564	0.462	0.523	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3
3	P04259	564	564	0.491	0.557	K2C6B_HUMAN Keratin, type II cytoskeletal 6B OS=Homo sapiens OX=9606 GN=KRT6B PE=1 SV=5
4	P04264	567	644	0.485	0.481	K2C1_HUMAN Keratin, type II cytoskeletal 1 OS=Homo sapiens OX=9606 GN=KRT1 PE=1 SV=6
5	P13647	555	590	0.480	0.520	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
6	P19013	546	520	0.465	0.571	K2C4_HUMAN Keratin, type II cytoskeletal 4 OS=Homo sapiens OX=9606 GN=KRT4 PE=1 SV=5
7	P35908	1238	639	1.000	1.000	K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens OX=9606 GN=KRT2 PE=1 SV=2
8	P48668	554	564	0.485	0.550	K2C6C_HUMAN Keratin, type II cytoskeletal 6C OS=Homo sapiens OX=9606 GN=KRT6C PE=1 SV=3
9	P50446	538	553	0.397	0.459	K2C6A_MOUSE Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3
10	Q0IIN1	526	578	0.459	0.507	Q0IIN1_HUMAN Keratin 77 OS=Homo sapiens OX=9606 GN=KRT77 PE=1 SV=1
11	Q14CN4	525	511	0.463	0.579	K2C72_HUMAN Keratin, type II cytoskeletal 72 OS=Homo sapiens OX=9606 GN=KRT72 PE=1 SV=2
12	Q3SY84	551	523	0.490	0.598	K2C71_HUMAN Keratin, type II cytoskeletal 71 OS=Homo sapiens OX=9606 GN=KRT71 PE=1 SV=3
13	Q3TTY5	613	707	0.446	0.403	K22E_MOUSE Keratin, type II cytoskeletal 2 epidermal OS=Mus musculus OX=10090 GN=Krt2 PE=1 SV=1
14	Q3UV17	549	594	0.549	0.591	K22O_MOUSE Keratin, type II cytoskeletal 2 oral OS=Mus musculus OX=10090 GN=Krt76 PE=1 SV=1
15	Q5XKE5	556	535	0.451	0.538	K2C79_HUMAN Keratin, type II cytoskeletal 79 OS=Homo sapiens OX=9606 GN=KRT79 PE=1 SV=2
16	Q6IFZ6	526	572	0.452	0.505	K2C1B_MOUSE Keratin, type II cytoskeletal 1b OS=Mus musculus OX=10090 GN=Krt77 PE=1 SV=1
17	Q6P6Q2	536	576	0.397	0.441	K2C5_RAT Keratin, type II cytoskeletal 5 OS=Rattus norvegicus OX=10116 GN=Krt5 PE=1 SV=1
18	Q7Z794	526	578	0.459	0.507	K2C1B_HUMAN Keratin, type II cytoskeletal 1b OS=Homo sapiens OX=9606 GN=KRT77 PE=1 SV=3
19	Q86Y46	561	540	0.485	0.574	K2C73_HUMAN Keratin, type II cytoskeletal 73 OS=Homo sapiens OX=9606 GN=KRT73 PE=1 SV=1
20	Q8BGZ7	536	551	0.455	0.528	K2C75_MOUSE Keratin, type II cytoskeletal 75 OS=Mus musculus OX=10090 GN=Krt75 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11839 Alanine_zipper	2.5e+02	13.4	Alanine-zipper, major outer membrane lipoprotein
2	PF08614 ATG16	5.3e+02	12.2	Autophagy protein 16 (ATG16)
3	PF10473 CENP-F_leu_zip	3.7e+02	12.6	Leucine-rich repeats of kinetochore protein Cenp-F/LEK1
4	PF06698 DUF1192	4.2e+02	12.4	Protein of unknown function (DUF1192)
5	PF05335 DUF745	2.9e+02	12.6	Protein of unknown function (DUF745)
6	PF00038 Filament	9.9e-107	368.7	Intermediate filament protein
7	PF05130 FlgN	6	18.8	FlgN protein
8	PF09486 HrpB7	5.4e+02	12.4	Bacterial type III secretion protein (HrpB7)
9	PF16208 Keratin_2_head	3.8e-34	129.6	Keratin type II head
10	PF18595 Nuf2_DHR10-like	43	15.6	Nuf2, DHR10-like domain
11	PF04102 SlyX	42	16.2	SlyX
12	PF10824 T7SS_ESX_EspC	4.2e+02	12.8	Excreted virulence factor EspC, type VII ESX diderm
13	PF07926 TPR_MLP1_2	3.6	19.0	TPR/MLP1/MLP2-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000310861

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252244	0.934	Keratin, type II cytoskeletal 1
2	9606.ENSP00000342710	0.901	Keratin, type II cytoskeletal 1b
3	9606.ENSP00000252242	0.890	Keratin, type II cytoskeletal 5
4	9606.ENSP00000269576	0.888	Keratin, type I cytoskeletal 10
5	9606.ENSP00000308720	0.835	Trypsin-1
6	9606.ENSP00000301466	0.720	Sterol O-acyltransferase 2
7	9606.ENSP00000301464	0.641	Insulin-like growth factor-binding protein 6
8	9606.ENSP00000357731	0.610	Loricrin
9	9606.ENSP00000307014	0.602	Keratin, type II cytoskeletal 73
10	9606.ENSP00000293745	0.575	Keratin, type II cytoskeletal 72
11	9606.ENSP00000311687	0.556	Magnesium transporter NIPA4
12	9606.ENSP00000411070	0.552	Late cornified envelope protein 6A
13	9606.ENSP00000307240	0.545	Keratin, type II cytoskeletal 74
14	9606.ENSP00000357789	0.540	Filaggrin
15	9606.ENSP00000257951	0.537	Keratin, type II cuticular Hb4
16	9606.ENSP00000267119	0.537	Keratin, type II cytoskeletal 71
17	9606.ENSP00000355124	0.536	Keratin, type I cytoskeletal 19
18	9606.ENSP00000369349	0.532	Keratin, type II cuticular Hb1
19	9606.ENSP00000257901	0.530	Keratin, type II cuticular Hb5
20	9606.ENSP00000293670	0.529	Keratin, type II cuticular Hb3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005198	1.000	structural molecule activity
GO:0005515	1.000	protein binding
GO:0005200	0.901	structural constituent of cytoskeleton
GO:0030280	0.618	structural constituent of skin epidermis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0048856	0.982	anatomical structure development
GO:0008544	0.959	epidermis development
GO:0043588	0.934	skin development
GO:0030855	0.895	epithelial cell differentiation
GO:0009913	0.890	epidermal cell differentiation
GO:0030216	0.823	keratinocyte differentiation
GO:0071704	0.747	organic substance metabolic process
GO:0044238	0.664	primary metabolic process
GO:0006807	0.604	nitrogen compound metabolic process
GO:0071840	0.535	cellular component organization or biogenesis
GO:1901564	0.517	organonitrogen compound metabolic process
GO:0065007	0.506	biological regulation
GO:0050789	0.495	regulation of biological process
GO:0016043	0.455	cellular component organization
GO:0043170	0.427	macromolecule metabolic process
GO:0043412	0.412	macromolecule modification
GO:0032501	0.403	multicellular organismal process
GO:0036211	0.380	protein modification process
GO:0050794	0.355	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0005829	0.999	cytosol
GO:0005882	0.999	intermediate filament
GO:0043227	0.998	membrane-bounded organelle
GO:0043231	0.986	intracellular membrane-bounded organelle
GO:0070062	0.986	extracellular exosome
GO:0005886	0.976	plasma membrane
GO:0005634	0.975	nucleus
GO:0001533	0.745	cornified envelope
GO:0045095	0.403	keratin filament

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]