StarFunc result for job id P35913

User Input

>input (854 residues)
MSLSEEQARSFLDQNPDFARQYFGKKLSPENVAAACEDGCPPDCDSLRDLCQVEESTALL
ELVQDMQESINMERVVFKVLRRLCTLLQADRCSLFMYRQRNGVAELATRLFSVQPDSVLE
DCLVPPDSEIVFPLDIGVVGHVAQTKKMVNVEDVAECPHFSSFADELTDYKTKNMLATPI
MNGKDVVAVIMAVNKLNGPFFTSEDEDVFLKYLNFATLYLKIYHLSYLHNCETRRGQVLL
WSANKVFEELTDIERQFHKAFYTVRAYLNCERYSVGLLDMTKEKEFFDVWSVLMGESQPY
SGPRTPDGREIVFYKVIDYVLHGKEEIKVIPTPSADHWALASGLPSYVAESGFICNIMNA
SADEMFKFQEGALDDSGWLIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDEQDEVLMES
LTQFLGWSVMNTDTYDKMNKLENRKDIAQDMVLYHVKCDRDEIQLILPTRARLGKEPADC
DEDELGEILKEELPGPTTFDIYEFHFSDLECTELDLVKCGIQMYYELGVVRKFQIPQEVL
VRFLFSISKGYRRITYHNWRHGFNVAQTMFTLLMTGKLKSYYTDLEAFAMVTAGLCHDID
HRGTNNLYQMKSQNPLAKLHGSSILERHHLEFGKFLLSEETLNIYQNLNRRQHEHVIHLM
DIAIIATDLALYFKKRAMFQKIVDESKNYQDKKSWVEYLSLETTRKEIVMAMMMTACDLS
AITKPWEVQSKVALLVAAEFWEQGDLERTVLDQQPIPMMDRNKAAELPKLQVGFIDFVCT
FVYKEFSRFHEEILPMFDRLQNNRKEWKALADEYEAKVKALEEKEEEERVAAKKVGTEIC
NGGPAPKSSTCCIL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZDI8	0.500	0.499	0.000	856	0.930	0.928	D3ZDI8.pdb.gz	D3ZDI8_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde6b PE=3 SV=1
2	AFDB:P16499	0.477	0.474	3.483E-104	860	0.719	0.714	P16499.pdb.gz	PDE6A_HUMAN Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha OS=Homo sapiens OX=9606 GN=PDE6A PE=1 SV=4
3	PDB:6mzbB	0.492	0.520	8.826E-103	807	0.876	0.927	6mzbB.pdb.gz	Cryo-EM structure of phosphodiesterase 6 reveals insights into the allosteric regulation of type I phosphodiesterases.
4	AFDB:Q91ZQ1	0.909	0.902	5.289E-99	861	0.635	0.630	Q91ZQ1.pdb.gz	PDE6C_MOUSE Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha' OS=Mus musculus OX=10090 GN=Pde6c PE=2 SV=1
5	AFDB:A0A0R4IUY2	0.498	0.499	7.251E-99	852	0.617	0.619	A0A0R4IUY2.pdb.gz
6	AFDB:P51160	0.477	0.475	3.355E-98	858	0.642	0.639	P51160.pdb.gz	PDE6C_HUMAN Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha' OS=Homo sapiens OX=9606 GN=PDE6C PE=1 SV=2
7	PDB:7jsnA	0.461	0.479	1.248E-89	820	0.703	0.732	7jsnA.pdb.gz	Structure of the Visual Signaling Complex between Transducin and Phosphodiesterase 6.
8	AFDB:Q9VFI9	0.432	0.336	3.016E-55	1118	0.314	0.240	Q9VFI9.pdb.gz	PDE6_DROME cGMP-specific 3',5'-cyclic phosphodiesterase OS=Drosophila melanogaster OX=7227 GN=Pde6 PE=1 SV=4
9	AFDB:Q9VJ79	0.411	0.247	1.214E-53	1451	0.297	0.175	Q9VJ79.pdb.gz	PDE11_DROME Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11 OS=Drosophila melanogaster OX=7227 GN=Pde11 PE=1 SV=4
10	AFDB:Q8VID6	0.393	0.363	3.271E-53	935	0.317	0.290	Q8VID6.pdb.gz	PDE11_RAT Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A OS=Rattus norvegicus OX=10116 GN=Pde11a PE=1 SV=1
11	AFDB:O76074	0.399	0.390	9.095E-50	875	0.301	0.294	O76074.pdb.gz	PDE5A_HUMAN cGMP-specific 3',5'-cyclic phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE5A PE=1 SV=2
12	AFDB:B3VTJ2	0.373	0.339	2.960E-41	941	0.261	0.237	B3VTJ2.pdb.gz	B3VTJ2_MACMU Phosphodiesterase OS=Macaca mulatta OX=9544 GN=PDE2A3 PE=2 SV=1
13	PDB:3bjcA	0.337	0.896	2.950E-21	311	0.153	0.421	3bjcA.pdb.gz	An insight into the pharmacophores of phosphodiesterase-5 inhibitors from synthetic and crystal structural studies
14	PDB:4y86B	0.354	0.899	9.823E-18	326	0.103	0.270	4y86B.pdb.gz	Structural Asymmetry of Phosphodiesterase-9A and a Unique Pocket for Selective Binding of a Potent Enantiomeric Inhibitor.
15	PDB:7rzwB	0.195	0.193	1.739E-4	864	0.081	0.080	7rzwB.pdb.gz	Plant phytochrome B is an asymmetric dimer with unique signalling potential.
16	PDB:1f5mB	0.149	0.615	1.321E-3	177	0.035	0.169	1f5mB.pdb.gz
17	PDB:1vhmB	0.147	0.640	1.731E-3	160	0.028	0.150	1vhmB.pdb.gz
18	PDB:4zmuA	0.150	0.345	3.896E-3	341	0.027	0.067	4zmuA.pdb.gz
19	PDB:5loeA	0.139	0.373	5.587E-3	258	0.035	0.116	5loeA.pdb.gz	Structure of the Branched-chain Amino Acid and GTP-sensing Global Regulator, CodY, from Bacillus subtilis.
20	PDB:2w1tA	0.109	0.430	2.064E-2	175	0.022	0.109	2w1tA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZDI8	0.0	1649	856	0.925	0.923	D3ZDI8_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde6b PE=3 SV=1
2	P11541	0.0	1276	859	0.726	0.722	PDE6A_BOVIN Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha OS=Bos taurus OX=9913 GN=PDE6A PE=1 SV=3
3	P16499	0.0	1280	860	0.720	0.715	PDE6A_HUMAN Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha OS=Homo sapiens OX=9606 GN=PDE6A PE=1 SV=4
4	P23439	0.0	1652	853	0.919	0.920	PDE6B_BOVIN Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta OS=Bos taurus OX=9913 GN=PDE6B PE=1 SV=1
5	P23440	0.0	1659	856	0.929	0.926	PDE6B_MOUSE Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta OS=Mus musculus OX=10090 GN=Pde6b PE=2 SV=3
6	P27664	0.0	1277	859	0.728	0.724	PDE6A_MOUSE Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha OS=Mus musculus OX=10090 GN=Pde6a PE=2 SV=3
7	P35913	0.0	1783	854	1.000	1.000	PDE6B_HUMAN Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta OS=Homo sapiens OX=9606 GN=PDE6B PE=1 SV=2
8	P51160	0.0	1165	858	0.644	0.641	PDE6C_HUMAN Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha' OS=Homo sapiens OX=9606 GN=PDE6C PE=1 SV=2
9	Q6P4P8	0.0	1108	852	0.615	0.616	Q6P4P8_DANRE Phosphodiesterase OS=Danio rerio OX=7955 GN=zgc:73085 PE=1 SV=1
10	Q91ZQ1	0.0	1139	861	0.637	0.632	PDE6C_MOUSE Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha' OS=Mus musculus OX=10090 GN=Pde6c PE=2 SV=1
11	Q9VFI9	3.41e-144	456	1118	0.308	0.235	PDE6_DROME cGMP-specific 3',5'-cyclic phosphodiesterase OS=Drosophila melanogaster OX=7227 GN=Pde6 PE=1 SV=4
12	Q8VID6	6.90e-141	442	935	0.301	0.275	PDE11_RAT Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A OS=Rattus norvegicus OX=10116 GN=Pde11a PE=1 SV=1
13	Q9HCR9	2.24e-138	436	933	0.300	0.274	PDE11_HUMAN Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A OS=Homo sapiens OX=9606 GN=PDE11A PE=1 SV=2
14	O54735	3.29e-130	412	833	0.301	0.309	PDE5A_RAT cGMP-specific 3',5'-cyclic phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde5a PE=2 SV=1
15	O76074	3.94e-129	410	875	0.299	0.291	PDE5A_HUMAN cGMP-specific 3',5'-cyclic phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE5A PE=1 SV=2
16	Q8CG03	1.10e-128	409	865	0.303	0.299	PDE5A_MOUSE cGMP-specific 3',5'-cyclic phosphodiesterase OS=Mus musculus OX=10090 GN=Pde5a PE=1 SV=2
17	Q9VJ79	1.79e-128	421	1451	0.297	0.175	PDE11_DROME Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11 OS=Drosophila melanogaster OX=7227 GN=Pde11 PE=1 SV=4
18	P14099	1.18e-84	292	921	0.247	0.229	PDE2A_BOVIN cGMP-dependent 3',5'-cyclic phosphodiesterase OS=Bos taurus OX=9913 GN=PDE2A PE=1 SV=2
19	G1U4Q4	1.76e-83	289	936	0.247	0.225	G1U4Q4_RABIT Phosphodiesterase OS=Oryctolagus cuniculus OX=9986 GN=PDE2A PE=3 SV=2
20	Q01062	9.65e-83	287	928	0.262	0.241	PDE2A_RAT cGMP-dependent 3',5'-cyclic phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde2a PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01590 GAF	6.5e-24	96.5	GAF domain
2	PF13185 GAF_2	6.5e-09	47.6	GAF domain
3	PF13492 GAF_3	0.0098	27.7	GAF domain
4	PF00233 PDEase_I	6.7e-67	237.2	3'5'-cyclic nucleotide phosphodiesterase
5	PF15714 SpoVT_C	3.1e+02	12.8	Stage V sporulation protein T C-terminal, transcription factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000420295

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000251102	0.998	Cyclic nucleotide-gated cation channel beta-1
2	9606.ENSP00000328412	0.998	Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma
3	9606.ENSP00000384264	0.977	cGMP-gated cation channel alpha-1
4	9606.ENSP00000232461	0.973	Guanine nucleotide-binding protein G(t) subunit alpha-1
5	9606.ENSP00000255266	0.969	Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha
6	9606.ENSP00000266395	0.956	Retinal cone rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma
7	9606.ENSP00000261837	0.945	Guanine nucleotide-binding protein subunit beta-5
8	9606.ENSP00000334134	0.939	Regulator of G-protein signaling 9-binding protein
9	9606.ENSP00000230381	0.934	Peripherin-2
10	9606.ENSP00000262406	0.919	Regulator of G-protein signaling 9
11	9606.ENSP00000316605	0.874	Cyclic nucleotide-gated cation channel beta-3
12	9606.ENSP00000355969	0.871	Plays a critical role in the regulation of enzymes involved in nucleotide cycle in photoreceptors (PubMed:29515371, PubMed:21928830, PubMed:21078983, PubMed:27471269, PubMed:30559291). Inhibits the basal catalytic activity and the GCAP-stimulated activity of GUCY2D and GUCY2F, two retinal guanylyl cyclases involved in the production of cGMP in photoreceptors (PubMed:21928830, PubMed:27471269, PubMed:29515371, PubMed:30559291). Involved in the transport of GUCY2D and GUCY2F to their target sites in the photoreceptor outer segment . Up-regulates the activity of GUK1, a kinase that plays [...]
13	9606.ENSP00000254854	0.863	Retinal guanylyl cyclase 1
14	9606.ENSP00000251337	0.854	Guanine nucleotide-binding protein G(t) subunit alpha-2
15	9606.ENSP00000248572	0.852	Guanine nucleotide-binding protein G(T) subunit gamma-T1
16	9606.ENSP00000361669	0.850	Homeobox protein ESX1
17	9606.ENSP00000218006	0.809	Retinal guanylyl cyclase 2
18	9606.ENSP00000348772	0.809	Membrane-associated phosphatidylinositol transfer protein 1
19	9606.ENSP00000261170	0.789	Heat-stable enterotoxin receptor
20	9606.ENSP00000341083	0.789	Atrial natriuretic peptide receptor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004114	0.995	3',5'-cyclic-nucleotide phosphodiesterase activity
GO:0047555	0.991	3',5'-cyclic-GMP phosphodiesterase activity
GO:0005488	0.990	binding
GO:0005515	0.965	protein binding
GO:0004115	0.910	3',5'-cyclic-AMP phosphodiesterase activity
GO:1901363	0.677	heterocyclic compound binding
GO:0097159	0.677	organic cyclic compound binding
GO:0030551	0.462	cyclic nucleotide binding
GO:0032553	0.437	ribonucleotide binding
GO:0032555	0.430	purine ribonucleotide binding
GO:0043168	0.419	anion binding
GO:0030553	0.380	cGMP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051606	0.985	detection of stimulus
GO:0009987	0.984	cellular process
GO:0032501	0.983	multicellular organismal process
GO:0050789	0.980	regulation of biological process
GO:0009583	0.949	detection of light stimulus
GO:0050794	0.933	regulation of cellular process
GO:0007601	0.919	visual perception
GO:0048856	0.805	anatomical structure development
GO:0051716	0.705	cellular response to stimulus
GO:0007154	0.671	cell communication
GO:0023052	0.659	signaling
GO:0007165	0.651	signal transduction
GO:0007275	0.570	multicellular organism development
GO:0150063	0.561	visual system development
GO:0009584	0.549	detection of visible light
GO:0007602	0.533	phototransduction
GO:0001654	0.440	eye development
GO:0007603	0.411	phototransduction, visible light
GO:0008219	0.352	cell death

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005929	0.998	cilium
GO:0001750	0.994	photoreceptor outer segment
GO:0031090	0.993	organelle membrane
GO:0097381	0.919	photoreceptor disc membrane
GO:0005622	0.816	intracellular anatomical structure
GO:0005737	0.717	cytoplasm
GO:0043229	0.606	intracellular organelle
GO:0043231	0.560	intracellular membrane-bounded organelle
GO:0098588	0.326	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:14653	0.995	a nucleoside 3',5'-cyclic phosphate + H2O = a nucleoside 5'-phosphate + H(+)
EC:3.1.4.17	0.995	3',5'-cyclic-nucleotide phosphodiesterase.
RHEA:16957	0.991	3',5'-cyclic GMP + H2O = GMP + H(+)
EC:3.1.4.35	0.991	3',5'-cyclic-GMP phosphodiesterase.
RHEA:25277	0.910	3',5'-cyclic AMP + H2O = AMP + H(+)
EC:3.1.4.53	0.910	3',5'-cyclic-AMP phosphodiesterase.

[back to server]