StarFunc result for job id P35914

User Input

>input (325 residues)
MAAMRKALPRRLVGLASLRAVSTSSMGTLPKRVKIVEVGPRDGLQNEKNIVSTPVKIKLI
DMLSEAGLSVIETTSFVSPKWVPQMGDHTEVLKGIQKFPGINYPVLTPNLKGFEAAVAAG
AKEVVIFGAASELFTKKNINCSIEESFQRFDAILKAAQSANISVRGYVSCALGCPYEGKI
SPAKVAEVTKKFYSMGCYEISLGDTIGVGTPGIMKDMLSAVMQEVPLAALAVHCHDTYGQ
ALANTLMALQMGVSVVDSSVAGLGGCPYAQGASGNLATEDLVYMLEGLGIHTGVNLQKLL
EAGNFICQALNRKTSSKVAQATCKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P35914	1.000	1.000	2.278E-67	325	1.000	1.000	P35914.pdb.gz	HMGCL_HUMAN Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Homo sapiens OX=9606 GN=HMGCL PE=1 SV=2
2	AFDB:P38060	0.969	0.969	1.047E-62	325	0.880	0.880	P38060.pdb.gz	HMGCL_MOUSE Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Mus musculus OX=10090 GN=Hmgcl PE=1 SV=2
3	PDB:2cw6A	0.907	0.996	1.055E-57	296	0.911	1.000	2cw6A.pdb.gz	Crystal structure of human 3-hydroxy-3-methylglutaryl-CoA Lyase: insights into catalysis and the molecular basis for hydroxymethylglutaric aciduria
4	AFDB:P35915	0.910	0.993	1.327E-56	298	0.726	0.792	P35915.pdb.gz	HMGCL_CHICK Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Gallus gallus OX=9031 GN=HMGCL PE=1 SV=1
5	AFDB:Q8TB92	0.919	0.808	1.350E-52	370	0.671	0.589	Q8TB92.pdb.gz	HMGC2_HUMAN 3-hydroxy-3-methylglutaryl-CoA lyase, cytoplasmic OS=Homo sapiens OX=9606 GN=HMGCLL1 PE=1 SV=3
6	AFDB:O81027	0.915	0.638	5.841E-48	468	0.582	0.404	O81027.pdb.gz	HMGCL_ARATH Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=HMGCL PE=1 SV=2
7	AFDB:Q9I2A0	0.899	0.973	1.344E-46	300	0.520	0.563	Q9I2A0.pdb.gz	LIUE_PSEAE 3-hydroxy-3-isohexenylglutaryl-CoA/hydroxy-methylglutaryl-CoA lyase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=liuE PE=1 SV=1
8	PDB:2ftpA	0.900	0.974	1.780E-44	300	0.520	0.563	2ftpA.pdb.gz
9	AFDB:Q5B2F7	0.878	0.480	2.395E-38	599	0.449	0.244	Q5B2F7.pdb.gz	Q5B2F7_EMENI hydroxymethylglutaryl-CoA lyase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05273 PE=3 SV=1
10	AFDB:A9WGE2	0.850	0.871	4.016E-30	317	0.298	0.306	A9WGE2.pdb.gz	CCL_CHLAA (R)-citramalyl-CoA lyase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) OX=324602 GN=ccl PE=1 SV=1
11	AFDB:D6XFK6	0.807	0.615	6.034E-23	431	0.274	0.206	D6XFK6.pdb.gz	D6XFK6_TRYB2 hydroxymethylglutaryl-CoA lyase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1H19.1420 PE=3 SV=1
12	AFDB:Q59VG1	0.741	0.575	5.383E-18	428	0.169	0.129	Q59VG1.pdb.gz	Q59VG1_CANAL homocitrate synthase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=LYS21 PE=3 SV=1
13	PDB:1nvmA	0.688	0.659	3.031E-15	340	0.178	0.171	1nvmA.pdb.gz	Crystal structure of a bifunctional aldolase-dehydrogenase: Sequestering a reactive and volatile intermediate
14	PDB:3ivtB	0.679	0.561	4.624E-15	400	0.191	0.155	3ivtB.pdb.gz	Crystal structure and functional analysis of homocitrate synthase, an essential enzyme in lysine biosynthesis.
15	PDB:4jn6C	0.706	0.679	9.535E-15	339	0.172	0.165	4jn6C.pdb.gz	Characterization of an Aldolase-Dehydrogenase Complex from the Cholesterol Degradation Pathway of Mycobacterium tuberculosis.
16	PDB:3ho8D	0.661	0.250	2.602E-12	934	0.185	0.064	3ho8D.pdb.gz	A Symmetrical Tetramer for S. aureus Pyruvate Carboxylase in Complex with Coenzyme A.
17	PDB:3figB	0.702	0.417	5.051E-12	577	0.163	0.092	3figB.pdb.gz	Crystal structure of LeuA from Mycobacterium tuberculosis, a key enzyme in leucine biosynthesis.
18	PDB:3bg5A	0.650	0.206	1.175E-11	1137	0.175	0.050	3bg5A.pdb.gz	Crystal structures of human and Staphylococcus aureus pyruvate carboxylase and molecular insights into the carboxyltransfer reaction.
19	PDB:4hnvB	0.672	0.229	2.423E-11	1033	0.175	0.055	4hnvB.pdb.gz	Characterizing the Importance of the Biotin Carboxylase Domain Dimer for Staphylococcus aureus Pyruvate Carboxylase Catalysis.
20	PDB:3bg5B	0.652	0.218	2.574E-11	1074	0.178	0.054	3bg5B.pdb.gz	Crystal structures of human and Staphylococcus aureus pyruvate carboxylase and molecular insights into the carboxyltransfer reaction.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P35914	0.0	665	325	1.000	1.000	HMGCL_HUMAN Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Homo sapiens OX=9606 GN=HMGCL PE=1 SV=2
2	P35915	0.0	510	298	0.726	0.792	HMGCL_CHICK Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Gallus gallus OX=9031 GN=HMGCL PE=1 SV=1
3	P38060	0.0	602	325	0.880	0.880	HMGCL_MOUSE Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Mus musculus OX=10090 GN=Hmgcl PE=1 SV=2
4	P97519	0.0	607	325	0.889	0.889	HMGCL_RAT Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Hmgcl PE=2 SV=1
5	Q8TB92	3.58e-164	464	370	0.665	0.584	HMGC2_HUMAN 3-hydroxy-3-methylglutaryl-CoA lyase, cytoplasmic OS=Homo sapiens OX=9606 GN=HMGCLL1 PE=1 SV=3
6	O81027	6.29e-135	393	468	0.578	0.402	HMGCL_ARATH Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=HMGCL PE=1 SV=2
7	Q9I2A0	1.99e-126	365	300	0.514	0.557	LIUE_PSEAE 3-hydroxy-3-isohexenylglutaryl-CoA/hydroxy-methylglutaryl-CoA lyase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=liuE PE=1 SV=1
8	Q5B2F7	2.30e-94	293	599	0.455	0.247	Q5B2F7_EMENI hydroxymethylglutaryl-CoA lyase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05273 PE=3 SV=1
9	A9WGE2	9.02e-57	188	317	0.298	0.306	CCL_CHLAA (R)-citramalyl-CoA lyase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) OX=324602 GN=ccl PE=1 SV=1
10	D6XFK6	2.07e-30	121	431	0.280	0.211	D6XFK6_TRYB2 hydroxymethylglutaryl-CoA lyase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1H19.1420 PE=3 SV=1
11	Q583A8	2.07e-30	121	431	0.280	0.211	Q583A8_9TRYP hydroxymethylglutaryl-CoA lyase OS=Trypanosoma brucei OX=5691 GN=Tb04.4J6.180 PE=3 SV=1
12	Q9FN52	1.31e-10	64.3	503	0.212	0.137	MAM3_ARATH Methylthioalkylmalate synthase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MAM3 PE=1 SV=1
13	Q57926	2.13e-10	63.5	406	0.222	0.177	AKSA_METJA Homocitrate synthase AksA OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=aksA PE=1 SV=3
14	P09151	2.38e-10	63.5	523	0.203	0.126	LEU1_ECOLI 2-isopropylmalate synthase OS=Escherichia coli (strain K12) OX=83333 GN=leuA PE=1 SV=5
15	Q9FG67	1.36e-08	58.2	506	0.129	0.083	MAM1_ARATH Methylthioalkylmalate synthase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MAM1 PE=1 SV=1
16	P9WMK5	5.81e-06	49.7	346	0.197	0.185	HOA_MYCTU 4-hydroxy-2-oxohexanoate aldolase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=hsaF PE=1 SV=1
17	Q9Y823	1.31e-05	48.9	418	0.166	0.129	HOSM_SCHPO Homocitrate synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lys4 PE=1 SV=1
18	Q9C550	1.77e-05	48.5	631	0.194	0.100	LEU12_ARATH 2-isopropylmalate synthase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=IPMS2 PE=1 SV=1
19	Q59VG1	3.22e-05	47.8	428	0.185	0.140	Q59VG1_CANAL homocitrate synthase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=LYS21 PE=3 SV=1
20	Q9UUE1	3.70e-05	47.8	1185	0.083	0.023	PYC_SCHPO Pyruvate carboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pyr1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00682 HMGL-like	9.6e-78	272.9	HMGL-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363614

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376184	0.979	D-beta-hydroxybutyrate dehydrogenase, mitochondrial
2	9606.ENSP00000358414	0.972	Hydroxymethylglutaryl-CoA synthase, mitochondrial
3	9606.ENSP00000196371	0.971	Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial
4	9606.ENSP00000364883	0.969	Methylglutaconyl-CoA hydratase, mitochondrial
5	9606.ENSP00000420914	0.966	Peroxisomal multifunctional enzyme type 2
6	9606.ENSP00000265838	0.963	Acetyl-CoA acetyltransferase, mitochondrial
7	9606.ENSP00000322706	0.961	Hydroxymethylglutaryl-CoA synthase, cytoplasmic
8	9606.ENSP00000333664	0.959	3-ketoacyl-CoA thiolase, peroxisomal
9	9606.ENSP00000296424	0.958	3-hydroxybutyrate dehydrogenase type 2
10	9606.ENSP00000231887	0.952	Peroxisomal bifunctional enzyme
11	9606.ENSP00000285093	0.951	3-ketoacyl-CoA thiolase, mitochondrial
12	9606.ENSP00000348775	0.948	Peroxisomal acyl-coenzyme A oxidase 3
13	9606.ENSP00000268533	0.945	Peroxisomal coenzyme A diphosphatase NUDT7
14	9606.ENSP00000293217	0.944	Peroxisomal acyl-coenzyme A oxidase 1
15	9606.ENSP00000325136	0.944	hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit beta
16	9606.ENSP00000323071	0.942	Acyl-coenzyme A thioesterase 4
17	9606.ENSP00000221418	0.941	Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial
18	9606.ENSP00000361914	0.941	Succinyl-CoA:3-ketoacid coenzyme A transferase 2, mitochondrial
19	9606.ENSP00000356015	0.940	Acetyl-CoA acetyltransferase, cytosolic
20	9606.ENSP00000238651	0.939	Acyl-coenzyme A thioesterase 2, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004419	0.996	hydroxymethylglutaryl-CoA lyase activity
GO:0043167	0.995	ion binding
GO:0005515	0.870	protein binding
GO:0043169	0.854	cation binding
GO:0016740	0.716	transferase activity
GO:0046872	0.583	metal ion binding
GO:0005198	0.572	structural molecule activity
GO:0030145	0.488	manganese ion binding
GO:0016746	0.447	acyltransferase activity
GO:0000287	0.430	magnesium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.997	cellular metabolic process
GO:0071704	0.996	organic substance metabolic process
GO:0044281	0.995	small molecule metabolic process
GO:0044238	0.995	primary metabolic process
GO:0006629	0.975	lipid metabolic process
GO:0006807	0.967	nitrogen compound metabolic process
GO:1901564	0.957	organonitrogen compound metabolic process
GO:0019752	0.939	carboxylic acid metabolic process
GO:1901568	0.938	fatty acid derivative metabolic process
GO:0046395	0.929	carboxylic acid catabolic process
GO:1901576	0.912	organic substance biosynthetic process
GO:0044249	0.885	cellular biosynthetic process
GO:0044283	0.880	small molecule biosynthetic process
GO:0006091	0.876	generation of precursor metabolites and energy
GO:0006520	0.830	amino acid metabolic process
GO:0008610	0.814	lipid biosynthetic process
GO:1901570	0.761	fatty acid derivative biosynthetic process
GO:0009081	0.717	branched-chain amino acid metabolic process
GO:0009063	0.605	amino acid catabolic process
GO:1901605	0.561	alpha-amino acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.985	intracellular organelle lumen
GO:0005829	0.969	cytosol
GO:0005759	0.848	mitochondrial matrix
GO:0016020	0.842	membrane
GO:0005777	0.823	peroxisome
GO:0031907	0.733	microbody lumen
GO:0005782	0.699	peroxisomal matrix
GO:0031090	0.346	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:24404	0.996	(3S)-hydroxy-3-methylglutaryl-CoA = acetoacetate + acetyl-CoA
EC:4.1.3.4	0.996	hydroxymethylglutaryl-CoA lyase.
EC:2.-.-.-	0.716	Transferases.
EC:2.3.-.-	0.447	Acyltransferases.

[back to server]