StarFunc result for job id P35916

User Input

>input (1363 residues)
MQRGAALCLRLWLCLGLLDGLVSGYSMTPPTLNITEESHVIDTGDSLSISCRGQHPLEWA
WPGAQEAPATGDKDSEDTGVVRDCEGTDARPYCKVLLLHEVHANDTGSYVCYYKYIKARI
EGTTAASSYVFVRDFEQPFINKPDTLLVNRKDAMWVPCLVSIPGLNVTLRSQSSVLWPDG
QEVVWDDRRGMLVSTPLLHDALYLQCETTWGDQDFLSNPFLVHITGNELYDIQLLPRKSL
ELLVGEKLVLNCTVWAEFNSGVTFDWDYPGKQAERGKWVPERRSQQTHTELSSILTIHNV
SQHDLGSYVCKANNGIQRFRESTEVIVHENPFISVEWLKGPILEATAGDELVKLPVKLAA
YPPPEFQWYKDGKALSGRHSPHALVLKEVTEASTGTYTLALWNSAAGLRRNISLELVVNV
PPQIHEKEASSPSIYSRHSRQALTCTAYGVPLPLSIQWHWRPWTPCKMFAQRSLRRRQQQ
DLMPQCRDWRAVTTQDAVNPIESLDTWTEFVEGKNKTVSKLVIQNANVSAMYKCVVSNKV
GQDERLIYFYVTTIPDGFTIESKPSEELLEGQPVLLSCQADSYKYEHLRWYRLNLSTLHD
AHGNPLLLDCKNVHLFATPLAASLEEVAPGARHATLSLSIPRVAPEHEGHYVCEVQDRRS
HDKHCHKKYLSVQALEAPRLTQNLTDLLVNVSDSLEMQCLVAGAHAPSIVWYKDERLLEE
KSGVDLADSNQKLSIQRVREEDAGRYLCSVCNAKGCVNSSASVAVEGSEDKGSMEIVILV
GTGVIAVFFWVLLLLIFCNMRRPAHADIKTGYLSIIMDPGEVPLEEQCEYLSYDASQWEF
PRERLHLGRVLGYGAFGKVVEASAFGIHKGSSCDTVAVKMLKEGATASEHRALMSELKIL
IHIGNHLNVVNLLGACTKPQGPLMVIVEFCKYGNLSNFLRAKRDAFSPCAEKSPEQRGRF
RAMVELARLDRRRPGSSDRVLFARFSKTEGGARRASPDQEAEDLWLSPLTMEDLVCYSFQ
VARGMEFLASRKCIHRDLAARNILLSESDVVKICDFGLARDIYKDPDYVRKGSARLPLKW
MAPESIFDKVYTTQSDVWSFGVLLWEIFSLGASPYPGVQINEEFCQRLRDGTRMRAPELA
TPAIRRIMLNCWSGDPKARPAFSELVEILGDLLQGRGLQEEEEVCMAPRSSQSSEEGSFS
QVSTMALHIAQADAEDSPPSLQRHSLAARYYNWVSFPGCLARGAETRGSSRMKTFEEFPM
TPTTYKGSVDNQTDSGMVLASEEFEQIESRHRQESGFSCKGPGQNVAVTRAHPDSQGRRR
RPERGARGGQVFYNSEYGELSEPSEEDHCSPSARVTFFTDNSY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B3DKP1	0.475	0.504	0.000	1272	0.385	0.413	B3DKP1.pdb.gz	B3DKP1_DANRE receptor protein-tyrosine kinase OS=Danio rerio OX=7955 GN=VEGFR1 PE=2 SV=1
2	AFDB:P35916	1.000	1.000	0.000	1363	1.000	1.000	P35916.pdb.gz	VGFR3_HUMAN Vascular endothelial growth factor receptor 3 OS=Homo sapiens OX=9606 GN=FLT4 PE=1 SV=3
3	AFDB:P35917	0.533	0.533	0.000	1363	0.874	0.874	P35917.pdb.gz	VGFR3_MOUSE Vascular endothelial growth factor receptor 3 OS=Mus musculus OX=10090 GN=Flt4 PE=1 SV=1
4	AFDB:Q5GIT4	0.333	0.335	0.000	1357	0.408	0.410	Q5GIT4.pdb.gz	VGFR2_DANRE Vascular endothelial growth factor receptor 2 OS=Danio rerio OX=7955 GN=kdr PE=1 SV=2
5	AFDB:P16234	0.309	0.373	5.996E-74	1089	0.236	0.295	P16234.pdb.gz	PGFRA_HUMAN Platelet-derived growth factor receptor alpha OS=Homo sapiens OX=9606 GN=PDGFRA PE=1 SV=1
6	AFDB:P10721	0.211	0.290	1.307E-65	976	0.222	0.310	P10721.pdb.gz	KIT_HUMAN Mast/stem cell growth factor receptor Kit OS=Homo sapiens OX=9606 GN=KIT PE=1 SV=1
7	AFDB:P36888	0.212	0.288	1.955E-56	993	0.184	0.253	P36888.pdb.gz	FLT3_HUMAN Receptor-type tyrosine-protein kinase FLT3 OS=Homo sapiens OX=9606 GN=FLT3 PE=1 SV=2
8	AFDB:Q09147	0.203	0.261	4.110E-54	1052	0.200	0.259	Q09147.pdb.gz	FGFR2_DROME Fibroblast growth factor receptor homolog 2 OS=Drosophila melanogaster OX=7227 GN=btl PE=2 SV=3
9	AFDB:Q10656	0.210	0.273	1.314E-48	1040	0.180	0.237	Q10656.pdb.gz	EGL15_CAEEL Myoblast growth factor receptor egl-15 OS=Caenorhabditis elegans OX=6239 GN=egl-15 PE=1 SV=1
10	AFDB:A0A0G2K210	0.210	0.348	2.779E-48	802	0.174	0.296	A0A0G2K210.pdb.gz	A0A0G2K210_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr3 PE=1 SV=2
11	PDB:1e07A	0.107	0.180	1.017E-24	642	0.074	0.157	1e07A.pdb.gz
12	PDB:5oj2B	0.105	0.179	1.123E-21	692	0.087	0.171	5oj2B.pdb.gz
13	PDB:1k9aB	0.179	0.539	1.311E-19	441	0.088	0.272	1k9aB.pdb.gz
14	PDB:2h8hA	0.177	0.516	3.253E-19	445	0.078	0.238	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
15	PDB:4fl2A	0.179	0.422	1.000E-18	555	0.074	0.182	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
16	PDB:4k2rA	0.174	0.416	4.018E-18	551	0.067	0.167	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
17	PDB:7sqcO0	0.100	0.108	4.459E-17	1140	0.059	0.070	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
18	PDB:6s73A	0.169	0.783	1.693E-15	269	0.049	0.249	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
19	PDB:5a42A	0.081	0.074	8.423E-15	1597	0.079	0.067	5a42A.pdb.gz
20	PDB:2rcjC	0.078	0.160	2.206E-14	523	0.069	0.180	2rcjC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B3DKP1	0.0	855	1272	0.387	0.414	B3DKP1_DANRE receptor protein-tyrosine kinase OS=Danio rerio OX=7955 GN=VEGFR1 PE=2 SV=1
2	B5A927	0.0	543	295	0.203	0.939	B5A927_HUMAN Fms related receptor tyrosine kinase 4 OS=Homo sapiens OX=9606 GN=FLT4 PE=1 SV=1
3	E9PD35	0.0	2696	1306	0.952	0.993	E9PD35_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=FLT4 PE=1 SV=1
4	F1MWF1	0.0	1056	1356	0.426	0.428	F1MWF1_BOVIN receptor protein-tyrosine kinase OS=Bos taurus OX=9913 GN=KDR PE=3 SV=1
5	F1NW21	0.0	1076	1348	0.434	0.438	F1NW21_CHICK receptor protein-tyrosine kinase OS=Gallus gallus OX=9031 GN=KDR PE=3 SV=1
6	L7RSL3	0.0	929	1338	0.384	0.392	L7RSL3_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=FLT1 PE=3 SV=1
7	O08775	0.0	1013	1343	0.417	0.423	VGFR2_RAT Vascular endothelial growth factor receptor 2 OS=Rattus norvegicus OX=10116 GN=Kdr PE=1 SV=1
8	P17948	0.0	929	1338	0.384	0.392	VGFR1_HUMAN Vascular endothelial growth factor receptor 1 OS=Homo sapiens OX=9606 GN=FLT1 PE=1 SV=2
9	P35916	0.0	2833	1363	1.000	1.000	VGFR3_HUMAN Vascular endothelial growth factor receptor 3 OS=Homo sapiens OX=9606 GN=FLT4 PE=1 SV=3
10	P35917	0.0	2425	1363	0.875	0.875	VGFR3_MOUSE Vascular endothelial growth factor receptor 3 OS=Mus musculus OX=10090 GN=Flt4 PE=1 SV=1
11	P35918	0.0	1030	1345	0.426	0.431	VGFR2_MOUSE Vascular endothelial growth factor receptor 2 OS=Mus musculus OX=10090 GN=Kdr PE=1 SV=2
12	P35968	0.0	1064	1356	0.437	0.440	VGFR2_HUMAN Vascular endothelial growth factor receptor 2 OS=Homo sapiens OX=9606 GN=KDR PE=1 SV=2
13	P35969	0.0	931	1333	0.406	0.415	VGFR1_MOUSE Vascular endothelial growth factor receptor 1 OS=Mus musculus OX=10090 GN=Flt1 PE=1 SV=1
14	P53767	0.0	920	1336	0.405	0.413	VGFR1_RAT Vascular endothelial growth factor receptor 1 OS=Rattus norvegicus OX=10116 GN=Flt1 PE=2 SV=1
15	Q5GIT4	0.0	1004	1357	0.410	0.412	VGFR2_DANRE Vascular endothelial growth factor receptor 2 OS=Danio rerio OX=7955 GN=kdr PE=1 SV=2
16	Q5MD89	0.0	1404	1357	0.543	0.545	VGFR3_DANRE Vascular endothelial growth factor receptor 3 OS=Danio rerio OX=7955 GN=flt4 PE=2 SV=1
17	Q677M1	0.0	1088	1348	0.434	0.439	Q677M1_CHICK receptor protein-tyrosine kinase OS=Gallus gallus OX=9031 GN=Flk1 PE=2 SV=1
18	Q8AXB3	0.0	868	1302	0.390	0.409	VGFR4_DANRE Vascular endothelial growth factor receptor kdr-like OS=Danio rerio OX=7955 GN=kdrl PE=1 SV=1
19	Q91ZT1	0.0	2457	1363	0.871	0.871	VGFR3_RAT Vascular endothelial growth factor receptor 3 OS=Rattus norvegicus OX=10116 GN=Flt4 PE=1 SV=1
20	B6IDV6	3.95e-109	380	1468	0.253	0.235	B6IDV6_DROME PDGF- and VEGF-receptor related, isoform G OS=Drosophila melanogaster OX=7227 GN=Pvr PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	3.7	19.3	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	1.7	20.1	CD80-like C2-set immunoglobulin domain
3	PF12330 Haspin_kinase	2.9e+02	11.8	Haspin like kinase domain
4	PF07679 I-set	1.5e-37	138.8	Immunoglobulin I-set domain
5	PF00047 ig	3.2e-28	109.0	Immunoglobulin domain
6	PF13895 Ig_2	2.6e-38	141.5	Immunoglobulin domain
7	PF13927 Ig_3	7.1e-48	172.4	Immunoglobulin domain
8	PF18452 Ig_6	0.00037	31.8	Immunoglobulin domain
9	PF16706 Izumo-Ig	0.014	26.6	Izumo-like Immunoglobulin domain
10	PF00069 Pkinase	6.7e-36	135.6	Protein kinase domain
11	PF07714 PK_Tyr_Ser-Thr	1.1e-96	334.7	Protein tyrosine and serine/threonine kinase
12	PF07686 V-set	7.3e-12	56.8	Immunoglobulin V-set domain
13	PF17988 VEGFR-2_TMD	8.2e-16	68.5	VEGFR-2 Transmembrane domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261937

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000297904	0.999	Vascular endothelial growth factor D
2	9606.ENSP00000478570	0.999	Vascular endothelial growth factor A
3	9606.ENSP00000480043	0.999	Vascular endothelial growth factor C
4	9606.ENSP00000353582	0.998	Neuropilin-2
5	9606.ENSP00000401303	0.996	SHC-transforming protein 1
6	9606.ENSP00000263923	0.988	Vascular endothelial growth factor receptor 2
7	9606.ENSP00000282397	0.984	Vascular endothelial growth factor receptor 1
8	9606.ENSP00000376345	0.981	Growth factor receptor-bound protein 2
9	9606.ENSP00000265371	0.972	Neuropilin-1
10	9606.ENSP00000379350	0.961	Integrin beta-1
11	9606.ENSP00000300574	0.955	Adapter molecule crk
12	9606.ENSP00000263967	0.954	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
13	9606.ENSP00000293379	0.954	Integrin alpha-5
14	9606.ENSP00000346839	0.951	Fibronectin type III domain containing
15	9606.ENSP00000428056	0.950	Phosphatidylinositol 3-kinase regulatory subunit alpha
16	9606.ENSP00000256178	0.949	Lymphatic vessel endothelial hyaluronic acid receptor 1
17	9606.ENSP00000297268	0.945	Collagen alpha-2(I) chain
18	9606.ENSP00000345206	0.942	Recombining binding protein suppressor of hairless
19	9606.ENSP00000244007	0.941	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
20	9606.ENSP00000364163	0.940	Neurogenic locus notch homolog protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019838	1.000	growth factor binding
GO:0004714	1.000	transmembrane receptor protein tyrosine kinase activity
GO:0042802	0.945	identical protein binding
GO:0019899	0.873	enzyme binding
GO:0005021	0.814	vascular endothelial growth factor receptor activity
GO:0019902	0.720	phosphatase binding
GO:0046983	0.705	protein dimerization activity
GO:0019903	0.705	protein phosphatase binding
GO:0042803	0.689	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007165	0.976	signal transduction
GO:0007166	0.974	cell surface receptor signaling pathway
GO:0032501	0.973	multicellular organismal process
GO:0048856	0.971	anatomical structure development
GO:0048522	0.970	positive regulation of cellular process
GO:0007169	0.959	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0019222	0.945	regulation of metabolic process
GO:0007275	0.943	multicellular organism development
GO:0051239	0.936	regulation of multicellular organismal process
GO:0048731	0.925	system development
GO:0008284	0.920	positive regulation of cell population proliferation
GO:0048010	0.917	vascular endothelial growth factor receptor signaling pathway
GO:0048583	0.914	regulation of response to stimulus
GO:0030335	0.907	positive regulation of cell migration
GO:0009653	0.884	anatomical structure morphogenesis
GO:0071363	0.878	cellular response to growth factor stimulus
GO:0001945	0.876	lymph vessel development
GO:0048584	0.870	positive regulation of response to stimulus
GO:0009966	0.870	regulation of signal transduction
GO:0036303	0.837	lymph vessel morphogenesis
GO:0050678	0.829	regulation of epithelial cell proliferation
GO:0022603	0.825	regulation of anatomical structure morphogenesis
GO:0035295	0.815	tube development
GO:0048646	0.802	anatomical structure formation involved in morphogenesis
GO:0018212	0.800	peptidyl-tyrosine modification
GO:0016310	0.786	phosphorylation
GO:0030324	0.784	lung development
GO:0031323	0.766	regulation of cellular metabolic process
GO:1902531	0.765	regulation of intracellular signal transduction
GO:0060255	0.761	regulation of macromolecule metabolic process
GO:0009893	0.752	positive regulation of metabolic process
GO:1902533	0.742	positive regulation of intracellular signal transduction
GO:0001525	0.732	angiogenesis
GO:0001936	0.712	regulation of endothelial cell proliferation
GO:0051171	0.711	regulation of nitrogen compound metabolic process
GO:0080090	0.710	regulation of primary metabolic process
GO:0051094	0.709	positive regulation of developmental process
GO:0010604	0.687	positive regulation of macromolecule metabolic process
GO:0043408	0.679	regulation of MAPK cascade
GO:0048519	0.667	negative regulation of biological process
GO:0051174	0.646	regulation of phosphorus metabolic process
GO:0006468	0.643	protein phosphorylation
GO:0043410	0.639	positive regulation of MAPK cascade
GO:0019220	0.637	regulation of phosphate metabolic process
GO:0042325	0.599	regulation of phosphorylation
GO:0001946	0.556	lymphangiogenesis
GO:0042327	0.555	positive regulation of phosphorylation
GO:0001934	0.522	positive regulation of protein phosphorylation
GO:0048523	0.507	negative regulation of cellular process
GO:0010632	0.472	regulation of epithelial cell migration
GO:0051128	0.440	regulation of cellular component organization
GO:0010468	0.417	regulation of gene expression
GO:0010941	0.401	regulation of cell death
GO:0040008	0.389	regulation of growth
GO:0042981	0.376	regulation of apoptotic process
GO:0042221	0.367	response to chemical
GO:0051240	0.365	positive regulation of multicellular organismal process
GO:0010634	0.314	positive regulation of epithelial cell migration
GO:0060548	0.304	negative regulation of cell death

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	1.000	plasma membrane
GO:0031981	0.998	nuclear lumen
GO:0005654	0.994	nucleoplasm
GO:0005829	0.988	cytosol
GO:0032991	0.742	protein-containing complex
GO:0012505	0.347	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.1	1.000	receptor protein-tyrosine kinase.

[back to server]