StarFunc result for job id P35968

User Input

>input (1356 residues)
MQSKVLLAVALWLCVETRAASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLD
WLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQD
YRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWD
SKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGE
KLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRS
DQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGSGMESLVEATVGERVRIPAKYLGYPPP
EIKWYKNGIPLESNHTIKAGHVLTIMEVSERDTGNYTVILTNPISKEKQSHVVSLVVYVP
PQIGEKSLISPVDSYQYGTTQTLTCTVYAIPPPHHIHWYWQLEEECANEPSQAVSVTNPY
PCEEWRSVEDFQGGNKIEVNKNQFALIEGKNKTVSTLVIQAANVSALYKCEAVNKVGRGE
RVISFHVTRGPEITLQPDMQPTEQESVSLWCTADRSTFENLTWYKLGPQPLPIHVGELPT
PVCKNLDTLWKLNATMFSNSTNDILIMELKNASLQDQGDYVCLAQDRKTKKRHCVVRQLT
VLERVAPTITGNLENQTTSIGESIEVSCTASGNPPPQIMWFKDNETLVEDSGIVLKDGNR
NLTIRRVRKEDEGLYTCQACSVLGCAKVEAFFIIEGAQEKTNLEIIILVGTAVIAMFFWL
LLVIILRTVKRANGGELKTGYLSIVMDPDELPLDEHCERLPYDASKWEFPRDRLKLGKPL
GRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVN
LLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKTKGARFRQGKDYVGAIPVDLK
RRLDSITSSQSSASSGFVEEKSLSDVEEEEAPEDLYKDFLTLEHLICYSFQVAKGMEFLA
SRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDR
VYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTML
DCWHGEPSQRPTFSELVEHLGNLLQANAQQDGKDYIVLPISETLSMEEDSGLSLPTSPVS
CMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDS
GMVLASEELKTLEDRTKLSPSFGGMVPSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYS
SEEAELLKLIEIGVQTGSTAQILQPDSGTTLSSPPV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P35918	0.758	0.763	0.000	1345	0.858	0.865	P35918.pdb.gz	VGFR2_MOUSE Vascular endothelial growth factor receptor 2 OS=Mus musculus OX=10090 GN=Kdr PE=1 SV=2
2	AFDB:P35968	1.000	1.000	0.000	1356	1.000	1.000	P35968.pdb.gz	VGFR2_HUMAN Vascular endothelial growth factor receptor 2 OS=Homo sapiens OX=9606 GN=KDR PE=1 SV=2
3	AFDB:Q9I8N6	0.223	0.307	1.361E-69	977	0.202	0.280	Q9I8N6.pdb.gz	CSF1R_DANRE Macrophage colony-stimulating factor 1 receptor OS=Danio rerio OX=7955 GN=csf1r PE=2 SV=1
4	AFDB:P36888	0.226	0.305	2.689E-59	993	0.195	0.266	P36888.pdb.gz	FLT3_HUMAN Receptor-type tyrosine-protein kinase FLT3 OS=Homo sapiens OX=9606 GN=FLT3 PE=1 SV=2
5	AFDB:E7F1P1	0.236	0.333	6.499E-55	956	0.178	0.253	E7F1P1.pdb.gz	E7F1P1_DANRE receptor protein-tyrosine kinase OS=Danio rerio OX=7955 GN=flt3 PE=3 SV=1
6	AFDB:A4JYQ2	0.209	0.350	3.922E-53	802	0.191	0.323	A4JYQ2.pdb.gz
7	AFDB:P30530	0.196	0.290	9.878E-45	894	0.145	0.220	P30530.pdb.gz	UFO_HUMAN Tyrosine-protein kinase receptor UFO OS=Homo sapiens OX=9606 GN=AXL PE=1 SV=4
8	AFDB:Q00993	0.207	0.302	4.126E-43	888	0.148	0.226	Q00993.pdb.gz	UFO_MOUSE Tyrosine-protein kinase receptor UFO OS=Mus musculus OX=10090 GN=Axl PE=1 SV=2
9	AFDB:E9PSY0	0.220	0.324	4.583E-43	888	0.146	0.223	E9PSY0.pdb.gz	E9PSY0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Axl PE=1 SV=2
10	AFDB:Q07407	0.201	0.368	7.753E-43	729	0.145	0.270	Q07407.pdb.gz	FGFR1_DROME Fibroblast growth factor receptor homolog 1 OS=Drosophila melanogaster OX=7227 GN=htl PE=1 SV=3
11	PDB:1e07A	0.146	0.256	2.102E-23	642	0.089	0.188	1e07A.pdb.gz
12	PDB:1k9aB	0.177	0.527	5.191E-22	441	0.088	0.270	1k9aB.pdb.gz
13	PDB:5oj2B	0.101	0.176	6.078E-22	692	0.074	0.146	5oj2B.pdb.gz
14	PDB:2h8hA	0.176	0.504	4.075E-20	445	0.082	0.249	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
15	PDB:4fl2A	0.180	0.422	4.117E-19	555	0.082	0.200	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
16	PDB:4k2rA	0.179	0.425	1.379E-18	551	0.079	0.194	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
17	PDB:7sqcO0	0.119	0.129	7.980E-16	1140	0.045	0.054	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
18	PDB:7q1yA	0.102	0.101	4.071E-15	1374	0.065	0.064	7q1yA.pdb.gz
19	PDB:6s73A	0.178	0.813	4.766E-15	269	0.050	0.253	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
20	PDB:2rcjC	0.098	0.204	1.378E-13	523	0.067	0.174	2rcjC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B3DKP1	0.0	894	1272	0.400	0.427	B3DKP1_DANRE receptor protein-tyrosine kinase OS=Danio rerio OX=7955 GN=VEGFR1 PE=2 SV=1
2	E9PD35	0.0	1061	1306	0.436	0.453	E9PD35_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=FLT4 PE=1 SV=1
3	F1MWF1	0.0	2545	1356	0.911	0.911	F1MWF1_BOVIN receptor protein-tyrosine kinase OS=Bos taurus OX=9913 GN=KDR PE=3 SV=1
4	F1NW21	0.0	1966	1348	0.719	0.723	F1NW21_CHICK receptor protein-tyrosine kinase OS=Gallus gallus OX=9031 GN=KDR PE=3 SV=1
5	L7RSL3	0.0	1041	1338	0.440	0.446	L7RSL3_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=FLT1 PE=3 SV=1
6	O08775	0.0	2396	1343	0.855	0.864	VGFR2_RAT Vascular endothelial growth factor receptor 2 OS=Rattus norvegicus OX=10116 GN=Kdr PE=1 SV=1
7	P17948	0.0	1041	1338	0.440	0.446	VGFR1_HUMAN Vascular endothelial growth factor receptor 1 OS=Homo sapiens OX=9606 GN=FLT1 PE=1 SV=2
8	P35916	0.0	1060	1363	0.436	0.434	VGFR3_HUMAN Vascular endothelial growth factor receptor 3 OS=Homo sapiens OX=9606 GN=FLT4 PE=1 SV=3
9	P35917	0.0	1075	1363	0.432	0.430	VGFR3_MOUSE Vascular endothelial growth factor receptor 3 OS=Mus musculus OX=10090 GN=Flt4 PE=1 SV=1
10	P35918	0.0	2395	1345	0.859	0.866	VGFR2_MOUSE Vascular endothelial growth factor receptor 2 OS=Mus musculus OX=10090 GN=Kdr PE=1 SV=2
11	P35968	0.0	2815	1356	1.000	1.000	VGFR2_HUMAN Vascular endothelial growth factor receptor 2 OS=Homo sapiens OX=9606 GN=KDR PE=1 SV=2
12	P35969	0.0	982	1333	0.428	0.435	VGFR1_MOUSE Vascular endothelial growth factor receptor 1 OS=Mus musculus OX=10090 GN=Flt1 PE=1 SV=1
13	P53767	0.0	988	1336	0.429	0.436	VGFR1_RAT Vascular endothelial growth factor receptor 1 OS=Rattus norvegicus OX=10116 GN=Flt1 PE=2 SV=1
14	Q5GIT4	0.0	1272	1357	0.500	0.500	VGFR2_DANRE Vascular endothelial growth factor receptor 2 OS=Danio rerio OX=7955 GN=kdr PE=1 SV=2
15	Q5MD89	0.0	1088	1357	0.444	0.444	VGFR3_DANRE Vascular endothelial growth factor receptor 3 OS=Danio rerio OX=7955 GN=flt4 PE=2 SV=1
16	Q677M1	0.0	1988	1348	0.718	0.723	Q677M1_CHICK receptor protein-tyrosine kinase OS=Gallus gallus OX=9031 GN=Flk1 PE=2 SV=1
17	Q8AXB3	0.0	954	1302	0.423	0.441	VGFR4_DANRE Vascular endothelial growth factor receptor kdr-like OS=Danio rerio OX=7955 GN=kdrl PE=1 SV=1
18	Q91ZT1	0.0	1073	1363	0.442	0.439	VGFR3_RAT Vascular endothelial growth factor receptor 3 OS=Rattus norvegicus OX=10116 GN=Flt4 PE=1 SV=1
19	B6IDV6	5.21e-108	376	1468	0.257	0.238	B6IDV6_DROME PDGF- and VEGF-receptor related, isoform G OS=Drosophila melanogaster OX=7227 GN=Pvr PE=1 SV=1
20	Q8JFR5	1.05e-107	366	976	0.138	0.192	KITA_DANRE Mast/stem cell growth factor receptor kita OS=Danio rerio OX=7955 GN=kita PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08205 C2-set_2	1.4e-06	39.6	CD80-like C2-set immunoglobulin domain
2	PF12330 Haspin_kinase	2.2e+02	12.2	Haspin like kinase domain
3	PF20418 Herpes_gE_N	4.1e+02	12.2	Alphaherpesvirus glycoprotein E N-terminal
4	PF07679 I-set	5.5e-49	175.5	Immunoglobulin I-set domain
5	PF00047 ig	2.3e-29	112.7	Immunoglobulin domain
6	PF13895 Ig_2	1.2e-32	123.3	Immunoglobulin domain
7	PF13927 Ig_3	1.3e-54	194.0	Immunoglobulin domain
8	PF16680 Ig_4	0.042	25.8	T-cell surface glycoprotein CD3 delta chain
9	PF16681 Ig_5	1.3	20.8	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
10	PF18452 Ig_6	2.6	19.3	Immunoglobulin domain
11	PF16706 Izumo-Ig	0.028	25.7	Izumo-like Immunoglobulin domain
12	PF00069 Pkinase	2.3e-37	140.4	Protein kinase domain
13	PF07714 PK_Tyr_Ser-Thr	7.4e-98	338.5	Protein tyrosine and serine/threonine kinase
14	PF19974 TCAD9	4.6e+02	11.2	Ternary complex associated domain 9
15	PF07686 V-set	8.9e-14	63.0	Immunoglobulin V-set domain
16	PF17988 VEGFR-2_TMD	1.2e-14	64.8	VEGFR-2 Transmembrane domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263923

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265371	0.999	Neuropilin-1
2	9606.ENSP00000297904	0.999	Vascular endothelial growth factor D
3	9606.ENSP00000344115	0.999	Cadherin-5
4	9606.ENSP00000376123	0.999	SH2 domain-containing protein 2A
5	9606.ENSP00000401303	0.999	SHC-transforming protein 1
6	9606.ENSP00000417273	0.999	Cytoplasmic protein NCK1
7	9606.ENSP00000478570	0.999	Vascular endothelial growth factor A
8	9606.ENSP00000480043	0.999	Vascular endothelial growth factor C
9	9606.ENSP00000282397	0.998	Vascular endothelial growth factor receptor 1
10	9606.ENSP00000344456	0.998	Catenin beta-1
11	9606.ENSP00000451040	0.998	Placenta growth factor
12	9606.ENSP00000452786	0.998	Integrin beta-3
13	9606.ENSP00000457421	0.998	Platelet endothelial cell adhesion molecule
14	9606.ENSP00000268182	0.997	Ras GTPase-activating-like protein IQGAP1
15	9606.ENSP00000353582	0.997	Neuropilin-2
16	9606.ENSP00000376345	0.995	Growth factor receptor-bound protein 2
17	9606.ENSP00000233154	0.994	Cytoplasmic protein NCK2
18	9606.ENSP00000379350	0.994	Integrin beta-1
19	9606.ENSP00000422464	0.994	Platelet-derived growth factor C
20	9606.ENSP00000339191	0.993	Caveolin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019838	1.000	growth factor binding
GO:0004714	1.000	transmembrane receptor protein tyrosine kinase activity
GO:0042802	0.926	identical protein binding
GO:0005102	0.876	signaling receptor binding
GO:0005021	0.836	vascular endothelial growth factor receptor activity
GO:0044877	0.566	protein-containing complex binding
GO:0050839	0.543	cell adhesion molecule binding
GO:0005178	0.479	integrin binding
GO:0045296	0.463	cadherin binding
GO:0051879	0.410	Hsp90 protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0050896	0.985	response to stimulus
GO:0051716	0.977	cellular response to stimulus
GO:0007275	0.977	multicellular organism development
GO:0048522	0.977	positive regulation of cellular process
GO:0007154	0.975	cell communication
GO:0048731	0.972	system development
GO:0007165	0.970	signal transduction
GO:0071704	0.957	organic substance metabolic process
GO:0048519	0.952	negative regulation of biological process
GO:0044237	0.949	cellular metabolic process
GO:0043170	0.945	macromolecule metabolic process
GO:0050678	0.935	regulation of epithelial cell proliferation
GO:0007167	0.930	enzyme-linked receptor protein signaling pathway
GO:0001936	0.929	regulation of endothelial cell proliferation
GO:0009653	0.923	anatomical structure morphogenesis
GO:0048523	0.923	negative regulation of cellular process
GO:0044238	0.919	primary metabolic process
GO:0007169	0.915	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0006807	0.909	nitrogen compound metabolic process
GO:0022603	0.908	regulation of anatomical structure morphogenesis
GO:0014066	0.901	regulation of phosphatidylinositol 3-kinase signaling
GO:1901564	0.898	organonitrogen compound metabolic process
GO:1902533	0.897	positive regulation of intracellular signal transduction
GO:0043412	0.893	macromolecule modification
GO:0030154	0.889	cell differentiation
GO:0016310	0.888	phosphorylation
GO:0051240	0.880	positive regulation of multicellular organismal process
GO:0008284	0.876	positive regulation of cell population proliferation
GO:2000026	0.874	regulation of multicellular organismal development
GO:0006468	0.873	protein phosphorylation
GO:0014068	0.863	positive regulation of phosphatidylinositol 3-kinase signaling
GO:0019222	0.861	regulation of metabolic process
GO:0045765	0.847	regulation of angiogenesis
GO:0010632	0.841	regulation of epithelial cell migration
GO:0044093	0.839	positive regulation of molecular function
GO:0043408	0.837	regulation of MAPK cascade
GO:0050679	0.835	positive regulation of epithelial cell proliferation
GO:0043410	0.831	positive regulation of MAPK cascade
GO:0051094	0.828	positive regulation of developmental process
GO:0048513	0.823	animal organ development
GO:0010941	0.817	regulation of cell death
GO:0071363	0.817	cellular response to growth factor stimulus
GO:0060255	0.814	regulation of macromolecule metabolic process
GO:0060548	0.792	negative regulation of cell death
GO:0010634	0.782	positive regulation of epithelial cell migration
GO:0042221	0.774	response to chemical
GO:0010594	0.774	regulation of endothelial cell migration
GO:0001932	0.770	regulation of protein phosphorylation
GO:0043066	0.768	negative regulation of apoptotic process
GO:0035295	0.758	tube development
GO:0050790	0.754	regulation of catalytic activity
GO:0048010	0.752	vascular endothelial growth factor receptor signaling pathway
GO:0051247	0.747	positive regulation of protein metabolic process
GO:0010595	0.736	positive regulation of endothelial cell migration
GO:0009888	0.735	tissue development
GO:0045766	0.717	positive regulation of angiogenesis
GO:0051128	0.700	regulation of cellular component organization
GO:0031325	0.698	positive regulation of cellular metabolic process
GO:0046777	0.696	protein autophosphorylation
GO:0006950	0.690	response to stress
GO:0070887	0.672	cellular response to chemical stimulus
GO:0072359	0.672	circulatory system development
GO:0001944	0.657	vasculature development
GO:0001525	0.647	angiogenesis
GO:0001938	0.636	positive regulation of endothelial cell proliferation
GO:0018108	0.633	peptidyl-tyrosine phosphorylation
GO:0045595	0.629	regulation of cell differentiation
GO:0009628	0.553	response to abiotic stimulus
GO:0071840	0.528	cellular component organization or biogenesis
GO:0009605	0.521	response to external stimulus
GO:0016043	0.491	cellular component organization
GO:0060429	0.482	epithelium development
GO:0065008	0.480	regulation of biological quality
GO:0048870	0.472	cell motility
GO:0048729	0.450	tissue morphogenesis
GO:0010468	0.436	regulation of gene expression
GO:0010033	0.415	response to organic substance
GO:0060562	0.404	epithelial tube morphogenesis
GO:0009889	0.373	regulation of biosynthetic process
GO:0022414	0.364	reproductive process
GO:0016477	0.359	cell migration
GO:0009892	0.328	negative regulation of metabolic process
GO:0010556	0.311	regulation of macromolecule biosynthetic process
GO:0010605	0.308	negative regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	0.999	plasma membrane
GO:0043231	0.980	intracellular membrane-bounded organelle
GO:0012505	0.742	endomembrane system
GO:0031410	0.588	cytoplasmic vesicle
GO:0005576	0.469	extracellular region
GO:0005634	0.456	nucleus
GO:0005768	0.369	endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.1	1.000	receptor protein-tyrosine kinase.

[back to server]