StarFunc result for job id P35998

User Input

>input (433 residues)
MPDYLGADQRKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKIN
ELTGIKESDTGLAPPALWDLAADKQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAK
FVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGC
KEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRV
IGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTML
ELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHAR
SMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIKSY
AKFSATPRYMTYN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140VK70	0.906	0.906	2.476E-85	433	1.000	1.000	A0A140VK70.pdb.gz	A0A140VK70_HUMAN Testis secretory sperm-binding protein Li 197a OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:Q18787	0.845	0.842	6.246E-79	435	0.857	0.853	Q18787.pdb.gz	PRS7_CAEEL 26S proteasome regulatory subunit 7 OS=Caenorhabditis elegans OX=6239 GN=rpt-1 PE=1 SV=1
3	AFDB:Q86JA1	0.841	0.850	7.248E-75	428	0.771	0.780	Q86JA1.pdb.gz	PRS7_DICDI 26S proteasome regulatory subunit 7 OS=Dictyostelium discoideum OX=44689 GN=psmC2 PE=1 SV=1
4	AFDB:Q9SSB5	0.842	0.855	1.609E-73	426	0.785	0.798	Q9SSB5.pdb.gz	PRS7A_ARATH 26S proteasome regulatory subunit 7 homolog A OS=Arabidopsis thaliana OX=3702 GN=RPT1A PE=1 SV=1
5	AFDB:O42931	0.840	0.831	1.086E-71	438	0.737	0.728	O42931.pdb.gz	PRS7_SCHPO 26S proteasome regulatory subunit 7 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpt1 PE=1 SV=2
6	AFDB:P33299	0.839	0.779	3.932E-71	467	0.758	0.702	P33299.pdb.gz	PRS7_YEAST 26S proteasome regulatory subunit 7 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPT1 PE=1 SV=1
7	AFDB:D6XKG7	0.830	0.822	1.618E-65	437	0.633	0.627	D6XKG7.pdb.gz	D6XKG7_TRYB2 Proteasome regulatory ATPase subunit 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.22O10.570 PE=3 SV=1
8	PDB:6msjA	0.644	0.671	1.697E-60	413	0.954	1.000	6msjA.pdb.gz	Cryo-EM structures and dynamics of substrate-engaged human 26S proteasome.
9	PDB:6fvtH	0.839	0.852	6.983E-55	426	0.716	0.728	6fvtH.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.
10	PDB:7qo4H	0.799	0.880	9.305E-52	391	0.709	0.785	7qo4H.pdb.gz	Allosteric control of Ubp6 and the proteasome via a bidirectional switch.
11	AFDB:P41836	0.759	0.815	8.231E-48	403	0.430	0.462	P41836.pdb.gz	PRS8_SCHPO 26S proteasome regulatory subunit 8 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=let1 PE=3 SV=1
12	AFDB:Q94BQ2	0.763	0.788	4.759E-47	419	0.450	0.465	Q94BQ2.pdb.gz	PRS8B_ARATH 26S proteasome regulatory subunit 8 homolog B OS=Arabidopsis thaliana OX=3702 GN=RPT6B PE=1 SV=1
13	AFDB:P62195	0.753	0.801	7.168E-47	406	0.432	0.461	P62195.pdb.gz	PRS8_HUMAN 26S proteasome regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMC5 PE=1 SV=1
14	PDB:5l4gL	0.733	0.811	1.008E-41	389	0.400	0.445	5l4gL.pdb.gz	Structure of the human 26S proteasome at a resolution of 3.9 angstrom.
15	PDB:5mp9I	0.675	0.753	2.190E-39	385	0.351	0.395	5mp9I.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
16	PDB:5l4gM	0.729	0.759	2.767E-39	415	0.358	0.373	5l4gM.pdb.gz	Structure of the human 26S proteasome at a resolution of 3.9 angstrom.
17	PDB:5mp9L	0.722	0.801	1.343E-38	388	0.374	0.418	5mp9L.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
18	PDB:6msjB	0.705	0.741	4.325E-38	411	0.370	0.389	6msjB.pdb.gz	Cryo-EM structures and dynamics of substrate-engaged human 26S proteasome.
19	PDB:6fvtM	0.727	0.747	4.234E-37	421	0.367	0.378	6fvtM.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.
20	PDB:6fvtJ	0.524	0.557	1.287E-36	405	0.411	0.440	6fvtJ.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VK70	0.0	888	433	1.000	1.000	A0A140VK70_HUMAN Testis secretory sperm-binding protein Li 197a OS=Homo sapiens OX=9606 PE=2 SV=1
2	D6XKG7	0.0	558	437	0.626	0.620	D6XKG7_TRYB2 Proteasome regulatory ATPase subunit 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.22O10.570 PE=3 SV=1
3	O42931	0.0	670	438	0.732	0.724	PRS7_SCHPO 26S proteasome regulatory subunit 7 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpt1 PE=1 SV=2
4	P33299	0.0	663	467	0.734	0.681	PRS7_YEAST 26S proteasome regulatory subunit 7 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPT1 PE=1 SV=1
5	P35998	0.0	888	433	1.000	1.000	PRS7_HUMAN 26S proteasome regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMC2 PE=1 SV=3
6	P46471	0.0	887	433	0.998	0.998	PRS7_MOUSE 26S proteasome regulatory subunit 7 OS=Mus musculus OX=10090 GN=Psmc2 PE=1 SV=5
7	Q18787	0.0	785	435	0.857	0.853	PRS7_CAEEL 26S proteasome regulatory subunit 7 OS=Caenorhabditis elegans OX=6239 GN=rpt-1 PE=1 SV=1
8	Q63347	0.0	885	433	0.998	0.998	PRS7_RAT 26S proteasome regulatory subunit 7 OS=Rattus norvegicus OX=10116 GN=Psmc2 PE=1 SV=3
9	Q7KMQ0	0.0	830	433	0.917	0.917	Q7KMQ0_DROME 26S proteasome regulatory complex subunit p48B OS=Drosophila melanogaster OX=7227 GN=Rpt1 PE=1 SV=1
10	Q86JA1	0.0	707	428	0.776	0.785	PRS7_DICDI 26S proteasome regulatory subunit 7 OS=Dictyostelium discoideum OX=44689 GN=psmC2 PE=1 SV=1
11	Q9NCA0	0.0	558	437	0.626	0.620	Q9NCA0_9TRYP Proteasome regulatory ATPase subunit 1 OS=Trypanosoma brucei OX=5691 GN=Rpt1 PE=3 SV=1
12	Q9SSB5	0.0	716	426	0.792	0.805	PRS7A_ARATH 26S proteasome regulatory subunit 7 homolog A OS=Arabidopsis thaliana OX=3702 GN=RPT1A PE=1 SV=1
13	O18413	1.84e-121	361	405	0.404	0.432	PRS8_DROME 26S proteasome regulatory subunit 8 OS=Drosophila melanogaster OX=7227 GN=Rpt6 PE=1 SV=2
14	P62195	8.72e-121	359	406	0.402	0.429	PRS8_HUMAN 26S proteasome regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMC5 PE=1 SV=1
15	P62196	8.72e-121	359	406	0.402	0.429	PRS8_MOUSE 26S proteasome regulatory subunit 8 OS=Mus musculus OX=10090 GN=Psmc5 PE=1 SV=1
16	P62198	8.72e-121	359	406	0.402	0.429	PRS8_RAT 26S proteasome regulatory subunit 8 OS=Rattus norvegicus OX=10116 GN=Psmc5 PE=1 SV=1
17	Q9C5U3	1.63e-119	356	419	0.460	0.475	PRS8A_ARATH 26S proteasome regulatory subunit 8 homolog A OS=Arabidopsis thaliana OX=3702 GN=RPT6A PE=1 SV=1
18	Q94BQ2	1.74e-118	353	419	0.402	0.415	PRS8B_ARATH 26S proteasome regulatory subunit 8 homolog B OS=Arabidopsis thaliana OX=3702 GN=RPT6B PE=1 SV=1
19	O17071	4.19e-115	345	406	0.409	0.436	PRS10_CAEEL Probable 26S proteasome regulatory subunit 10B OS=Caenorhabditis elegans OX=6239 GN=rpt-4 PE=1 SV=2
20	Q01939	1.09e-114	343	405	0.395	0.422	PRS8_YEAST 26S proteasome regulatory subunit 8 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPT6 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	4.7e-37	138.8	ATPase family associated with various cellular activities (AAA)
2	PF13173 AAA_14	2.4e+02	13.1	AAA domain
3	PF13191 AAA_16	5.3	18.9	AAA ATPase domain
4	PF13238 AAA_18	50	15.9	AAA domain
5	PF07724 AAA_2	13	17.4	AAA domain (Cdc48 subfamily)
6	PF13401 AAA_22	0.2	23.4	AAA domain
7	PF13479 AAA_24	2.9e+02	12.6	AAA domain
8	PF13521 AAA_28	49	15.6	AAA domain
9	PF13671 AAA_33	39	15.8	AAA domain
10	PF07728 AAA_5	1.5	20.3	AAA domain (dynein-related subfamily)
11	PF12775 AAA_7	40	15.2	P-loop containing dynein motor region
12	PF17862 AAA_lid_3	1.7e-05	35.8	AAA+ lid domain
13	PF05673 DUF815	8.1	17.0	Protein of unknown function (DUF815)
14	PF18071 HMW1C_N	4.2e+02	12.0	HMW1C N-terminal
15	PF01695 IstB_IS21	4.7e+02	11.6	IstB-like ATP binding protein
16	PF01078 Mg_chelatase	2.2e+02	12.6	Magnesium chelatase, subunit ChlI
17	PF00910 RNA_helicase	3.4e+02	13.0	RNA helicase
18	PF05496 RuvB_N	27	16.0	Holliday junction DNA helicase RuvB P-loop domain
19	PF14532 Sigma54_activ_2	1.8e+02	13.7	Sigma-54 interaction domain
20	PF00437 T2SSE	4.4e+02	11.3	Type II/IV secretion system protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 43179.ENSSTOP00000004673

Rank	PPI partner	STRING score	Description
1	43179.ENSSTOP00000000551	0.999	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 4
2	43179.ENSSTOP00000001484	0.999	Uncharacterized protein
3	43179.ENSSTOP00000001596	0.999	Proteasome (prosome, macropain) subunit, beta type, 2
4	43179.ENSSTOP00000002412	0.999	Adhesion regulating molecule 1
5	43179.ENSSTOP00000003284	0.999	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 12
6	43179.ENSSTOP00000005600	0.999	Proteasome subunit alpha type
7	43179.ENSSTOP00000006369	0.999	Proteasome (prosome, macropain) subunit, beta type, 5
8	43179.ENSSTOP00000007390	0.999	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 2
9	43179.ENSSTOP00000008014	0.999	Uncharacterized protein
10	43179.ENSSTOP00000008396	0.999	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 1
11	43179.ENSSTOP00000008694	0.999	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 11
12	43179.ENSSTOP00000009493	0.999	Proteasome (prosome, macropain) subunit, beta type, 1
13	43179.ENSSTOP00000009511	0.999	Proteasome (prosome, macropain) subunit, alpha type, 4
14	43179.ENSSTOP00000010068	0.999	Proteasome (prosome, macropain) subunit, alpha type, 5
15	43179.ENSSTOP00000010562	0.999	Proteasome (prosome, macropain) subunit, alpha type, 6
16	43179.ENSSTOP00000010808	0.999	Proteasome (prosome, macropain) subunit, beta type, 4
17	43179.ENSSTOP00000011193	0.999	Proteasome endopeptidase complex
18	43179.ENSSTOP00000011204	0.999	Proteasome (prosome, macropain) 26S subunit, ATPase, 4
19	43179.ENSSTOP00000011269	0.999	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 6
20	43179.ENSSTOP00000011762	0.999	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140657	0.962	ATP-dependent activity
GO:0003824	0.546	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0006508	0.992	proteolysis
GO:0044265	0.975	cellular macromolecule catabolic process
GO:0043632	0.966	modification-dependent macromolecule catabolic process
GO:0051603	0.954	proteolysis involved in protein catabolic process
GO:0019941	0.943	modification-dependent protein catabolic process
GO:0006511	0.933	ubiquitin-dependent protein catabolic process
GO:0050789	0.645	regulation of biological process
GO:0032501	0.493	multicellular organismal process
GO:0019222	0.440	regulation of metabolic process
GO:0060255	0.385	regulation of macromolecule metabolic process
GO:0080090	0.355	regulation of primary metabolic process
GO:0050794	0.350	regulation of cellular process
GO:0032502	0.334	developmental process
GO:0051171	0.304	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0032991	0.995	protein-containing complex
GO:0005829	0.995	cytosol
GO:1905368	0.984	peptidase complex
GO:0043228	0.975	non-membrane-bounded organelle
GO:0140535	0.972	intracellular protein-containing complex
GO:1905369	0.972	endopeptidase complex
GO:0043232	0.972	intracellular non-membrane-bounded organelle
GO:0005634	0.957	nucleus
GO:0000502	0.846	proteasome complex
GO:0035770	0.816	ribonucleoprotein granule
GO:0036464	0.782	cytoplasmic ribonucleoprotein granule
GO:0031974	0.683	membrane-enclosed lumen
GO:0070013	0.648	intracellular organelle lumen
GO:0031981	0.578	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]