StarFunc result for job id P36404

User Input

>input (184 residues)
MGLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGF
KLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATL
LIFANKQDLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRI
FTAD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O08697	0.996	0.996	3.050E-39	184	0.951	0.951	O08697.pdb.gz	ARL2_RAT ADP-ribosylation factor-like protein 2 OS=Rattus norvegicus OX=10116 GN=Arl2 PE=1 SV=1
2	PDB:3doeA	0.924	0.900	2.485E-35	189	0.995	0.968	3doeA.pdb.gz	Crystal structure of the ARL2-GTP-BART complex reveals a novel recognition and binding mode of small GTPase with effector
3	AFDB:Q06849	0.972	0.972	1.104E-34	184	0.755	0.755	Q06849.pdb.gz	ARL2_DROME ADP-ribosylation factor-like protein 2 OS=Drosophila melanogaster OX=7227 GN=Arl2 PE=2 SV=2
4	AFDB:Q9ZPX1	0.955	0.950	9.151E-32	185	0.647	0.643	Q9ZPX1.pdb.gz	ARF5_ARATH ADP-ribosylation factor-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=ARL2 PE=2 SV=1
5	AFDB:Q19705	0.956	0.956	2.390E-31	184	0.625	0.625	Q19705.pdb.gz	ARL2_CAEEL ADP-ribosylation factor-like protein 2 OS=Caenorhabditis elegans OX=6239 GN=evl-20 PE=2 SV=2
6	AFDB:E9AEJ0	0.977	0.966	4.833E-31	186	0.625	0.618	E9AEJ0.pdb.gz	E9AEJ0_LEIMA Putative ADP-ribosylation factor-like 2, arl2 OS=Leishmania major OX=5664 GN=ARL2 PE=3 SV=1
7	AFDB:Q38BH5	0.957	0.947	2.394E-30	186	0.630	0.624	Q38BH5.pdb.gz	Q38BH5_TRYB2 ADP-ribosylation factor 6, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3000 PE=3 SV=1
8	AFDB:Q09767	0.910	0.900	1.045E-28	186	0.538	0.532	Q09767.pdb.gz	ARL_SCHPO ADP-ribosylation factor-like protein alp41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alp41 PE=3 SV=1
9	PDB:4zi2A	0.893	0.888	2.364E-26	185	0.511	0.508	4zi2A.pdb.gz	The Interaction of CCDC104/BARTL1 with Arl3 and Implications for Ciliary Function.
10	AFDB:P36405	0.866	0.875	3.111E-26	182	0.522	0.527	P36405.pdb.gz	ARL3_HUMAN ADP-ribosylation factor-like protein 3 OS=Homo sapiens OX=9606 GN=ARL3 PE=1 SV=2
11	AFDB:Q9VD64	0.865	0.888	7.623E-26	179	0.473	0.486	Q9VD64.pdb.gz	Q9VD64_DROME Dead end OS=Drosophila melanogaster OX=7227 GN=dnd PE=1 SV=2
12	AFDB:Q57VI8	0.898	0.871	1.050E-25	190	0.457	0.442	Q57VI8.pdb.gz	Q57VI8_TRYB2 ADP-ribosylation factor, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.2F2.550 PE=3 SV=1
13	PDB:1uptG	0.861	0.930	3.067E-23	170	0.397	0.429	1uptG.pdb.gz	Structural Basis for Arl1-Dependent Targeting of Homodimeric Grip Domains to the Golgi Apparatus
14	PDB:6bbpA	0.856	0.309	1.519E-22	520	0.418	0.148	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
15	PDB:3lvqE	0.849	0.377	4.816E-21	420	0.424	0.186	3lvqE.pdb.gz	The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
16	PDB:2h57B	0.833	0.915	1.625E-20	167	0.337	0.371	2h57B.pdb.gz	Crystal structure of human ADP-ribosylation factor-like 6 (CASP Target)
17	PDB:1mozA	0.722	0.743	2.386E-20	178	0.424	0.438	1mozA.pdb.gz	Structures of Yeast ARF2 and ARL1: DISTINCT ROLES FOR THE N TERMINUS IN THE STRUCTURE AND FUNCTION OF ARF FAMILY GTPases
18	PDB:3aq4A	0.716	0.771	4.524E-20	170	0.424	0.459	3aq4A.pdb.gz	Molecular insights into plant cell proliferation disturbance by Agrobacterium protein 6b
19	PDB:3lrpA	0.734	0.746	5.844E-20	181	0.429	0.436	3lrpA.pdb.gz	Structure of Plasmodium falciparum ADP-ribosylation factor 1.
20	PDB:2x77A	0.745	0.756	7.550E-20	181	0.435	0.442	2x77A.pdb.gz	Crystal Structure of Leishmania Major Adp Ribosylation Factor-Like 1 and a Classification of Related Gtpase Family Members in This Kinetoplastid.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P36404	1.96e-134	375	184	1.000	1.000	ARL2_HUMAN ADP-ribosylation factor-like protein 2 OS=Homo sapiens OX=9606 GN=ARL2 PE=1 SV=4
2	Q53YD8	1.96e-134	375	184	1.000	1.000	Q53YD8_HUMAN ADP-ribosylation factor-like protein 2 OS=Homo sapiens OX=9606 GN=hCG_23373 PE=2 SV=1
3	Q2TA37	2.10e-132	370	184	0.984	0.984	ARL2_BOVIN ADP-ribosylation factor-like protein 2 OS=Bos taurus OX=9913 GN=ARL2 PE=1 SV=1
4	Q9D0J4	2.57e-129	362	184	0.962	0.962	ARL2_MOUSE ADP-ribosylation factor-like protein 2 OS=Mus musculus OX=10090 GN=Arl2 PE=1 SV=1
5	O08697	2.69e-128	359	184	0.951	0.951	ARL2_RAT ADP-ribosylation factor-like protein 2 OS=Rattus norvegicus OX=10116 GN=Arl2 PE=1 SV=1
6	Q06849	8.59e-104	297	184	0.755	0.755	ARL2_DROME ADP-ribosylation factor-like protein 2 OS=Drosophila melanogaster OX=7227 GN=Arl2 PE=2 SV=2
7	Q19705	2.39e-84	248	184	0.625	0.625	ARL2_CAEEL ADP-ribosylation factor-like protein 2 OS=Caenorhabditis elegans OX=6239 GN=evl-20 PE=2 SV=2
8	Q9ZPX1	1.04e-78	234	185	0.647	0.643	ARF5_ARATH ADP-ribosylation factor-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=ARL2 PE=2 SV=1
9	E9AEJ0	9.51e-78	232	186	0.620	0.613	E9AEJ0_LEIMA Putative ADP-ribosylation factor-like 2, arl2 OS=Leishmania major OX=5664 GN=ARL2 PE=3 SV=1
10	Q38BH5	1.20e-77	231	186	0.630	0.624	Q38BH5_TRYB2 ADP-ribosylation factor 6, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3000 PE=3 SV=1
11	Q09767	1.95e-68	208	186	0.527	0.522	ARL_SCHPO ADP-ribosylation factor-like protein alp41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alp41 PE=3 SV=1
12	Q1MTE5	1.68e-67	206	182	0.522	0.527	ARL3_DANRE ADP-ribosylation factor-like protein 3 OS=Danio rerio OX=7955 GN=arl3 PE=2 SV=1
13	Q6PC92	4.08e-61	189	187	0.484	0.476	Q6PC92_DANRE ADP ribosylation factor-like GTPase 3, like 1 OS=Danio rerio OX=7955 GN=zgc:73049 PE=1 SV=1
14	P36405	6.99e-61	189	182	0.522	0.527	ARL3_HUMAN ADP-ribosylation factor-like protein 3 OS=Homo sapiens OX=9606 GN=ARL3 PE=1 SV=2
15	Q9WUL7	1.27e-60	188	182	0.522	0.527	ARL3_MOUSE ADP-ribosylation factor-like protein 3 OS=Mus musculus OX=10090 GN=Arl3 PE=1 SV=1
16	Q9VD64	1.43e-60	188	179	0.473	0.486	Q9VD64_DROME Dead end OS=Drosophila melanogaster OX=7227 GN=dnd PE=1 SV=2
17	P37996	3.33e-60	187	182	0.516	0.522	ARL3_RAT ADP-ribosylation factor-like protein 3 OS=Rattus norvegicus OX=10116 GN=Arl3 PE=1 SV=2
18	Q57XJ5	3.34e-60	187	178	0.489	0.506	Q57XJ5_TRYB2 ADP-ribosylation factor-like protein 3A, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.25B21.123 PE=3 SV=1
19	E9ADU4	1.15e-57	181	179	0.505	0.520	E9ADU4_LEIMA Putative ADP ribosylation factor 3 OS=Leishmania major OX=5664 GN=LMJF_29_0880 PE=3 SV=1
20	Q38D64	6.57e-57	179	182	0.440	0.445	Q38D64_TRYB2 ADP-ribosylation factor OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.4470 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00025 Arf	5.2e-70	245.9	ADP-ribosylation factor family
2	PF00503 G-alpha	2.9e-08	44.9	G-protein alpha subunit
3	PF00009 GTP_EFTU	38	15.3	Elongation factor Tu GTP binding domain
4	PF04670 Gtr1_RagA	0.00056	30.9	Gtr1/RagA G protein conserved region
5	PF01926 MMR_HSR1	0.023	26.2	50S ribosome-binding GTPase
6	PF00071 Ras	2.9e-07	41.7	Ras family
7	PF08477 Roc	3.1e-09	48.5	Ras of Complex, Roc, domain of DAPkinase
8	PF09439 SRPRB	6.9e-08	43.7	Signal recognition particle receptor beta subunit
9	PF05621 TniB	29	15.6	Bacterial TniB protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000246747

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000347719	0.999	Tubulin-specific chaperone D
2	9606.ENSP00000219204	0.998	ADP-ribosylation factor-like protein 2-binding protein
3	9606.ENSP00000337040	0.996	Protein unc-119 homolog A
4	9606.ENSP00000287600	0.987	Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta
5	9606.ENSP00000369703	0.962	Tubulin beta-2A chain
6	9606.ENSP00000259818	0.946	Tubulin beta-2B chain
7	9606.ENSP00000264071	0.929	Tubulin beta-4A chain
8	9606.ENSP00000341289	0.929	Tubulin beta-4B chain
9	9606.ENSP00000217133	0.927	Tubulin beta-1 chain
10	9606.ENSP00000318697	0.927	Tubulin beta-6 chain
11	9606.ENSP00000439170	0.915	Tubulin-specific chaperone E
12	9606.ENSP00000361967	0.901	Tubulin-specific chaperone C
13	9606.ENSP00000221855	0.835	Tubulin-folding cofactor B
14	9606.ENSP00000326342	0.783	ELMO domain-containing protein 2
15	9606.ENSP00000218340	0.730	Protein XRP2
16	9606.ENSP00000256078	0.702	GTPase KRas
17	9606.ENSP00000405574	0.681	F-box-like/WD repeat-containing protein TBL1XR1
18	9606.ENSP00000389810	0.669	Kinetochore-associated protein DSN1 homolog
19	9606.ENSP00000344942	0.658	Protein unc-119 homolog B
20	9606.ENSP00000230340	0.657	Bystin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0032561	0.981	guanyl ribonucleotide binding
GO:0043168	0.972	anion binding
GO:0005525	0.961	GTP binding
GO:0003824	0.938	catalytic activity
GO:0016817	0.907	hydrolase activity, acting on acid anhydrides
GO:0016462	0.904	pyrophosphatase activity
GO:0017111	0.892	ribonucleoside triphosphate phosphatase activity
GO:0003924	0.883	GTPase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0065007	0.958	biological regulation
GO:0050794	0.928	regulation of cellular process
GO:0071840	0.926	cellular component organization or biogenesis
GO:1902903	0.897	regulation of supramolecular fiber organization
GO:0051179	0.881	localization
GO:0032886	0.873	regulation of microtubule-based process
GO:0048518	0.861	positive regulation of biological process
GO:0031110	0.861	regulation of microtubule polymerization or depolymerization
GO:0043254	0.829	regulation of protein-containing complex assembly
GO:0048522	0.813	positive regulation of cellular process
GO:0016043	0.807	cellular component organization
GO:0032271	0.744	regulation of protein polymerization
GO:0051130	0.595	positive regulation of cellular component organization
GO:0051234	0.521	establishment of localization
GO:0006810	0.510	transport
GO:0031113	0.500	regulation of microtubule polymerization
GO:0051495	0.493	positive regulation of cytoskeleton organization
GO:0050896	0.426	response to stimulus
GO:0019222	0.368	regulation of metabolic process
GO:0031334	0.347	positive regulation of protein-containing complex assembly
GO:1902905	0.344	positive regulation of supramolecular fiber organization
GO:0006996	0.326	organelle organization
GO:0032273	0.324	positive regulation of protein polymerization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0043228	0.948	non-membrane-bounded organelle
GO:0043232	0.942	intracellular non-membrane-bounded organelle
GO:0070013	0.941	intracellular organelle lumen
GO:0005829	0.929	cytosol
GO:0005634	0.916	nucleus
GO:0012505	0.900	endomembrane system
GO:0031981	0.742	nuclear lumen
GO:0005856	0.594	cytoskeleton
GO:0016020	0.507	membrane
GO:0005794	0.504	Golgi apparatus
GO:0015630	0.483	microtubule cytoskeleton
GO:0005654	0.447	nucleoplasm
GO:0005739	0.419	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.-.-	0.907	Acting on acid anhydrides.
EC:3.6.1.-	0.904	In phosphorus-containing anhydrides.
RHEA:23680	0.892	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.892	nucleoside-triphosphate phosphatase.
RHEA:19669	0.883	GTP + H2O = GDP + H(+) + phosphate

[back to server]