StarFunc result for job id P36405

User Input

>input (182 residues)
MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQG
FKLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVP
VLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAK
KK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P36405	1.000	1.000	3.551E-41	182	1.000	1.000	P36405.pdb.gz	ARL3_HUMAN ADP-ribosylation factor-like protein 3 OS=Homo sapiens OX=9606 GN=ARL3 PE=1 SV=2
2	AFDB:Q6PC43	0.971	0.945	5.526E-34	187	0.775	0.754	Q6PC43.pdb.gz	Q6PC43_DANRE ADP ribosylation factor-like GTPase 3, like 2 OS=Danio rerio OX=7955 GN=zgc:73116 PE=2 SV=1
3	PDB:4zi2A	0.877	0.863	1.077E-33	185	0.967	0.951	4zi2A.pdb.gz	The Interaction of CCDC104/BARTL1 with Arl3 and Implications for Ciliary Function.
4	AFDB:Q6DI21	0.878	0.856	2.635E-30	187	0.747	0.727	Q6DI21.pdb.gz
5	AFDB:O45379	0.895	0.886	4.102E-30	184	0.632	0.625	O45379.pdb.gz	ARL3_CAEEL ADP-ribosylation factor-like protein 3 OS=Caenorhabditis elegans OX=6239 GN=arl-3 PE=1 SV=1
6	AFDB:Q9VD64	0.868	0.882	1.245E-28	179	0.637	0.648	Q9VD64.pdb.gz	Q9VD64_DROME Dead end OS=Drosophila melanogaster OX=7227 GN=dnd PE=1 SV=2
7	AFDB:Q57XJ5	0.860	0.879	8.916E-26	178	0.566	0.579	Q57XJ5.pdb.gz	Q57XJ5_TRYB2 ADP-ribosylation factor-like protein 3A, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.25B21.123 PE=3 SV=1
8	AFDB:E9ADU4	0.882	0.897	1.012E-25	179	0.566	0.575	E9ADU4.pdb.gz	E9ADU4_LEIMA Putative ADP ribosylation factor 3 OS=Leishmania major OX=5664 GN=LMJF_29_0880 PE=3 SV=1
9	AFDB:O08697	0.871	0.862	2.451E-25	184	0.522	0.516	O08697.pdb.gz	ARL2_RAT ADP-ribosylation factor-like protein 2 OS=Rattus norvegicus OX=10116 GN=Arl2 PE=1 SV=1
10	AFDB:Q06849	0.866	0.857	7.179E-25	184	0.484	0.478	Q06849.pdb.gz	ARL2_DROME ADP-ribosylation factor-like protein 2 OS=Drosophila melanogaster OX=7227 GN=Arl2 PE=2 SV=2
11	AFDB:Q9ZPX1	0.877	0.863	1.351E-24	185	0.484	0.476	Q9ZPX1.pdb.gz	ARF5_ARATH ADP-ribosylation factor-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=ARL2 PE=2 SV=1
12	PDB:3doeA	0.866	0.835	1.692E-24	189	0.522	0.503	3doeA.pdb.gz	Crystal structure of the ARL2-GTP-BART complex reveals a novel recognition and binding mode of small GTPase with effector
13	PDB:1uptG	0.849	0.907	1.326E-22	170	0.407	0.435	1uptG.pdb.gz	Structural Basis for Arl1-Dependent Targeting of Homodimeric Grip Domains to the Golgi Apparatus
14	PDB:2h57B	0.827	0.898	1.955E-20	167	0.335	0.365	2h57B.pdb.gz	Crystal structure of human ADP-ribosylation factor-like 6 (CASP Target)
15	PDB:6bbpA	0.831	0.301	1.955E-20	520	0.429	0.150	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
16	PDB:2x77A	0.768	0.772	8.364E-20	181	0.429	0.431	2x77A.pdb.gz	Crystal Structure of Leishmania Major Adp Ribosylation Factor-Like 1 and a Classification of Related Gtpase Family Members in This Kinetoplastid.
17	PDB:3lvqE	0.820	0.366	9.491E-20	420	0.418	0.181	3lvqE.pdb.gz	The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
18	PDB:3aq4A	0.754	0.802	4.326E-19	170	0.390	0.418	3aq4A.pdb.gz	Molecular insights into plant cell proliferation disturbance by Agrobacterium protein 6b
19	PDB:8d9rC	0.836	0.845	1.189E-18	180	0.418	0.422	8d9rC.pdb.gz	Self-assembly and structure of a clathrin-independent AP-1:Arf1 tubular membrane coat.
20	PDB:1mozA	0.760	0.776	1.738E-18	178	0.396	0.404	1mozA.pdb.gz	Structures of Yeast ARF2 and ARL1: DISTINCT ROLES FOR THE N TERMINUS IN THE STRUCTURE AND FUNCTION OF ARF FAMILY GTPases

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P36405	3.01e-134	374	182	1.000	1.000	ARL3_HUMAN ADP-ribosylation factor-like protein 3 OS=Homo sapiens OX=9606 GN=ARL3 PE=1 SV=2
2	Q9WUL7	1.78e-132	370	182	0.984	0.984	ARL3_MOUSE ADP-ribosylation factor-like protein 3 OS=Mus musculus OX=10090 GN=Arl3 PE=1 SV=1
3	P37996	6.73e-132	368	182	0.973	0.973	ARL3_RAT ADP-ribosylation factor-like protein 3 OS=Rattus norvegicus OX=10116 GN=Arl3 PE=1 SV=2
4	Q1MTE5	2.07e-128	359	182	0.945	0.945	ARL3_DANRE ADP-ribosylation factor-like protein 3 OS=Danio rerio OX=7955 GN=arl3 PE=2 SV=1
5	Q6PC92	6.39e-102	293	187	0.758	0.738	Q6PC92_DANRE ADP ribosylation factor-like GTPase 3, like 1 OS=Danio rerio OX=7955 GN=zgc:73049 PE=1 SV=1
6	Q6PC43	1.33e-97	282	187	0.775	0.754	Q6PC43_DANRE ADP ribosylation factor-like GTPase 3, like 2 OS=Danio rerio OX=7955 GN=zgc:73116 PE=2 SV=1
7	A0A140LG87	4.77e-95	275	186	0.769	0.753	A0A140LG87_DANRE ADP ribosylation factor-like GTPase 3, like 2 OS=Danio rerio OX=7955 GN=zgc:73116 PE=3 SV=1
8	Q9VD64	6.00e-86	252	179	0.637	0.648	Q9VD64_DROME Dead end OS=Drosophila melanogaster OX=7227 GN=dnd PE=1 SV=2
9	O45379	3.59e-85	250	184	0.637	0.630	ARL3_CAEEL ADP-ribosylation factor-like protein 3 OS=Caenorhabditis elegans OX=6239 GN=arl-3 PE=1 SV=1
10	Q57XJ5	1.75e-72	218	178	0.566	0.579	Q57XJ5_TRYB2 ADP-ribosylation factor-like protein 3A, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.25B21.123 PE=3 SV=1
11	E9ADU4	8.04e-69	209	179	0.516	0.525	E9ADU4_LEIMA Putative ADP ribosylation factor 3 OS=Leishmania major OX=5664 GN=LMJF_29_0880 PE=3 SV=1
12	O08697	1.08e-67	206	184	0.522	0.516	ARL2_RAT ADP-ribosylation factor-like protein 2 OS=Rattus norvegicus OX=10116 GN=Arl2 PE=1 SV=1
13	Q9D0J4	1.13e-67	206	184	0.522	0.516	ARL2_MOUSE ADP-ribosylation factor-like protein 2 OS=Mus musculus OX=10090 GN=Arl2 PE=1 SV=1
14	Q2TA37	1.77e-67	206	184	0.527	0.522	ARL2_BOVIN ADP-ribosylation factor-like protein 2 OS=Bos taurus OX=9913 GN=ARL2 PE=1 SV=1
15	P36404	5.71e-67	204	184	0.527	0.522	ARL2_HUMAN ADP-ribosylation factor-like protein 2 OS=Homo sapiens OX=9606 GN=ARL2 PE=1 SV=4
16	Q53YD8	5.71e-67	204	184	0.527	0.522	Q53YD8_HUMAN ADP-ribosylation factor-like protein 2 OS=Homo sapiens OX=9606 GN=hCG_23373 PE=2 SV=1
17	Q19705	7.62e-62	191	184	0.495	0.489	ARL2_CAEEL ADP-ribosylation factor-like protein 2 OS=Caenorhabditis elegans OX=6239 GN=evl-20 PE=2 SV=2
18	Q06849	2.96e-60	187	184	0.484	0.478	ARL2_DROME ADP-ribosylation factor-like protein 2 OS=Drosophila melanogaster OX=7227 GN=Arl2 PE=2 SV=2
19	Q09767	7.38e-56	176	186	0.467	0.457	ARL_SCHPO ADP-ribosylation factor-like protein alp41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alp41 PE=3 SV=1
20	E9AEJ0	3.47e-55	174	186	0.489	0.478	E9AEJ0_LEIMA Putative ADP-ribosylation factor-like 2, arl2 OS=Leishmania major OX=5664 GN=ARL2 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	1.6	20.6	ATPase family associated with various cellular activities (AAA)
2	PF13173 AAA_14	66	15.0	AAA domain
3	PF13238 AAA_18	24	16.9	AAA domain
4	PF00025 Arf	8.1e-69	242.1	ADP-ribosylation factor family
5	PF03599 CdhD	5.9e+02	10.5	CO dehydrogenase/acetyl-CoA synthase delta subunit
6	PF02492 cobW	35	15.4	CobW/HypB/UreG, nucleotide-binding domain
7	PF19400 DUF5975	1.8e+02	13.8	Family of unknown function (DUF5975)
8	PF02421 FeoB_N	1.6e+02	13.2	Ferrous iron transport protein B
9	PF00503 G-alpha	2.2e-11	55.1	G-protein alpha subunit
10	PF00009 GTP_EFTU	0.32	22.1	Elongation factor Tu GTP binding domain
11	PF04670 Gtr1_RagA	2.8e-08	45.0	Gtr1/RagA G protein conserved region
12	PF03308 MeaB	1.3e+02	13.0	Methylmalonyl Co-A mutase-associated GTPase MeaB
13	PF01926 MMR_HSR1	3.7e-05	35.2	50S ribosome-binding GTPase
14	PF05729 NACHT	98	14.3	NACHT domain
15	PF10662 PduV-EutP	36	15.6	Ethanolamine utilisation - propanediol utilisation
16	PF00071 Ras	4.5e-10	50.8	Ras family
17	PF08477 Roc	5.9e-11	54.1	Ras of Complex, Roc, domain of DAPkinase
18	PF03193 RsgA_GTPase	1.2e+02	14.0	RsgA GTPase
19	PF09439 SRPRB	1e-10	52.9	Signal recognition particle receptor beta subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000260746

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337040	0.999	Protein unc-119 homolog A
2	9606.ENSP00000344942	0.996	Protein unc-119 homolog B
3	9606.ENSP00000218340	0.993	Protein XRP2
4	9606.ENSP00000287600	0.991	Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta
5	9606.ENSP00000342699	0.988	Cilia- and flagella-associated protein 36
6	9606.ENSP00000338766	0.883	Nephrocystin-3
7	9606.ENSP00000243918	0.870	Protein SYS1 homolog
8	9606.ENSP00000219204	0.827	ADP-ribosylation factor-like protein 2-binding protein
9	9606.ENSP00000361967	0.826	Tubulin-specific chaperone C
10	9606.ENSP00000464443	0.813	Intraflagellar transport protein 20 homolog
11	9606.ENSP00000417610	0.771	Ras-related protein Rab-23
12	9606.ENSP00000295240	0.751	Bardet-Biedl syndrome 5 protein
13	9606.ENSP00000300935	0.747	Ras-related protein Rab-8A
14	9606.ENSP00000341344	0.734	ADP-ribosylation factor-binding protein GGA1
15	9606.ENSP00000320359	0.715	Intraflagellar transport protein 22 homolog
16	9606.ENSP00000317469	0.714	Bardet-Biedl syndrome 1 protein
17	9606.ENSP00000477352	0.699	Short coiled-coil protein
18	9606.ENSP00000264657	0.697	Signal transducer and activator of transcription 3
19	9606.ENSP00000347719	0.691	Tubulin-specific chaperone D
20	9606.ENSP00000264538	0.669	Intraflagellar transport protein 57 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0043168	0.996	anion binding
GO:0005525	0.993	GTP binding
GO:0019003	0.910	GDP binding
GO:0003824	0.773	catalytic activity
GO:0003924	0.733	GTPase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0016043	0.986	cellular component organization
GO:0051179	0.929	localization
GO:0065007	0.911	biological regulation
GO:0044782	0.910	cilium organization
GO:0050789	0.861	regulation of biological process
GO:0060271	0.852	cilium assembly
GO:0050794	0.828	regulation of cellular process
GO:0006810	0.789	transport
GO:0051641	0.732	cellular localization
GO:0008104	0.471	protein localization
GO:0050896	0.414	response to stimulus
GO:0023052	0.393	signaling
GO:0016192	0.371	vesicle-mediated transport
GO:0033365	0.331	protein localization to organelle
GO:0061512	0.314	protein localization to cilium

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0005737	0.999	cytoplasm
GO:0005856	0.999	cytoskeleton
GO:0015630	0.994	microtubule cytoskeleton
GO:0005929	0.989	cilium
GO:0005815	0.970	microtubule organizing center
GO:0005829	0.957	cytosol
GO:0043231	0.717	intracellular membrane-bounded organelle
GO:0016020	0.644	membrane
GO:0012505	0.621	endomembrane system
GO:0035869	0.509	ciliary transition zone
GO:0036064	0.324	ciliary basal body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.733	GTP + H2O = GDP + H(+) + phosphate

[back to server]