StarFunc result for job id P36406

User Input

>input (574 residues)
MATLVVNKLGAGVDSGRQGSRGTAVVKVLECGVCEDVFSLQGDKVPRLLLCGHTVCHDCL
TRLPLHGRAIRCPFDRQVTDLGDSGVWGLKKNFALLELLERLQNGPIGQYGAAEESIGIS
GESIIRCDEDEAHLASVYCTVCATHLCSECSQVTHSTKTLAKHRRVPLADKPHEKTMCSQ
HQVHAIEFVCLEEGCQTSPLMCCVCKEYGKHQGHKHSVLEPEANQIRASILDMAHCIRTF
TEEISDYSRKLVGIVQHIEGGEQIVEDGIGMAHTEHVPGTAENARSCIRAYFYDLHETLC
RQEEMALSVVDAHVREKLIWLRQQQEDMTILLSEVSAACLHCEKTLQQDDCRVVLAKQEI
TRLLETLQKQQQQFTEVADHIQLDASIPVTFTKDNRVHIGPKMEIRVVTLGLDGAGKTTI
LFKLKQDEFMQPIPTIGFNVETVEYKNLKFTIWDVGGKHKLRPLWKHYYLNTQAVVFVVD
SSHRDRISEAHSELAKLLTEKELRDALLLIFANKQDVAGALSVEEITELLSLHKLCCGRS
WYIQGCDARSGMGLYEGLDWLSRQLVAAGVLDVA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P36406	1.000	1.000	0.000	574	1.000	1.000	P36406.pdb.gz	TRI23_HUMAN E3 ubiquitin-protein ligase TRIM23 OS=Homo sapiens OX=9606 GN=TRIM23 PE=1 SV=1
2	AFDB:P61209	0.282	0.880	1.215E-25	182	0.181	0.571	P61209.pdb.gz	ARF1_DROME ADP-ribosylation factor 1 OS=Drosophila melanogaster OX=7227 GN=Arf1 PE=1 SV=2
3	AFDB:Q5AND9	0.281	0.883	1.638E-25	181	0.178	0.564	Q5AND9.pdb.gz	Q5AND9_CANAL ADP-ribosylation factor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ARF2 PE=1 SV=1
4	AFDB:Q38D64	0.279	0.874	2.209E-25	182	0.174	0.549	Q38D64.pdb.gz	Q38D64_TRYB2 ADP-ribosylation factor OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.4470 PE=3 SV=1
5	AFDB:O00909	0.282	0.880	4.017E-25	182	0.176	0.555	O00909.pdb.gz	ARF1_DICDI ADP-ribosylation factor 1 OS=Dictyostelium discoideum OX=44689 GN=arfA PE=1 SV=3
6	AFDB:P40945	0.284	0.897	5.750E-25	180	0.171	0.544	P40945.pdb.gz	ARF2_DROME ADP-ribosylation factor 2 OS=Drosophila melanogaster OX=7227 GN=Arf102F PE=2 SV=2
7	AFDB:P40940	0.281	0.879	9.277E-25	182	0.159	0.500	P40940.pdb.gz	ARF3_ARATH ADP-ribosylation factor 3 OS=Arabidopsis thaliana OX=3702 GN=ARF3 PE=1 SV=2
8	AFDB:G3N3N1	0.286	0.925	1.046E-24	175	0.162	0.531	G3N3N1.pdb.gz	G3N3N1_BOVIN ADP-ribosylation factor 6 OS=Bos taurus OX=9913 GN=ARF6 PE=3 SV=1
9	AFDB:G5EFK4	0.280	0.885	1.687E-24	180	0.172	0.550	G5EFK4.pdb.gz	G5EFK4_CAEEL ADP-ribosylation factor OS=Caenorhabditis elegans OX=6239 GN=arf-3 PE=1 SV=1
10	AFDB:P18085	0.283	0.894	2.275E-24	180	0.167	0.533	P18085.pdb.gz	ARF4_HUMAN ADP-ribosylation factor 4 OS=Homo sapiens OX=9606 GN=ARF4 PE=1 SV=3
11	PDB:6bbpA	0.282	0.311	1.401E-22	520	0.159	0.175	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
12	PDB:1uptG	0.278	0.923	2.547E-22	170	0.148	0.500	1uptG.pdb.gz	Structural Basis for Arl1-Dependent Targeting of Homodimeric Grip Domains to the Golgi Apparatus
13	PDB:3lvqE	0.277	0.378	3.755E-21	420	0.159	0.217	3lvqE.pdb.gz	The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
14	PDB:8d9rC	0.279	0.869	3.755E-21	180	0.179	0.572	8d9rC.pdb.gz	Self-assembly and structure of a clathrin-independent AP-1:Arf1 tubular membrane coat.
15	PDB:4zi2A	0.277	0.847	7.248E-21	185	0.118	0.368	4zi2A.pdb.gz	The Interaction of CCDC104/BARTL1 with Arl3 and Implications for Ciliary Function.
16	PDB:3doeA	0.279	0.833	2.257E-20	189	0.131	0.397	3doeA.pdb.gz	Crystal structure of the ARL2-GTP-BART complex reveals a novel recognition and binding mode of small GTPase with effector
17	PDB:5uf8A	0.246	0.802	3.044E-20	161	0.174	0.621	5uf8A.pdb.gz	Crystal structure of the ARF family small GTPase ARF2 from Candida albicans in complex with GDP
18	PDB:1z6xA	0.245	0.729	7.030E-20	175	0.167	0.549	1z6xA.pdb.gz	Structure Of Human ADP-Ribosylation Factor 4
19	PDB:3aq4A	0.237	0.740	7.464E-20	170	0.169	0.571	3aq4A.pdb.gz	Molecular insights into plant cell proliferation disturbance by Agrobacterium protein 6b
20	PDB:3lrpA	0.246	0.718	1.278E-19	181	0.155	0.492	3lrpA.pdb.gz	Structure of Plasmodium falciparum ADP-ribosylation factor 1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P36406	0.0	1181	574	1.000	1.000	TRI23_HUMAN E3 ubiquitin-protein ligase TRIM23 OS=Homo sapiens OX=9606 GN=TRIM23 PE=1 SV=1
2	P36407	0.0	1145	573	0.972	0.974	TRI23_RAT E3 ubiquitin-protein ligase TRIM23 OS=Rattus norvegicus OX=10116 GN=Trim23 PE=2 SV=2
3	Q8BGX0	0.0	1156	574	0.977	0.977	TRI23_MOUSE E3 ubiquitin-protein ligase TRIM23 OS=Mus musculus OX=10090 GN=Trim23 PE=2 SV=1
4	P61209	1.91e-70	226	182	0.185	0.582	ARF1_DROME ADP-ribosylation factor 1 OS=Drosophila melanogaster OX=7227 GN=Arf1 PE=1 SV=2
5	B5DG68	2.33e-70	226	181	0.181	0.575	B5DG68_SALSA ADP-ribosylation factor OS=Salmo salar OX=8030 GN=arf1l PE=2 SV=1
6	B5X3Q1	4.66e-70	225	181	0.181	0.575	B5X3Q1_SALSA ADP-ribosylation factor OS=Salmo salar OX=8030 GN=ARF1 PE=2 SV=1
7	Q10943	4.86e-70	225	181	0.179	0.569	ARF12_CAEEL ADP-ribosylation factor 1-like 2 OS=Caenorhabditis elegans OX=6239 GN=arf-1.2 PE=2 SV=2
8	P84077	7.52e-70	224	181	0.179	0.569	ARF1_HUMAN ADP-ribosylation factor 1 OS=Homo sapiens OX=9606 GN=ARF1 PE=1 SV=2
9	P84078	7.52e-70	224	181	0.179	0.569	ARF1_MOUSE ADP-ribosylation factor 1 OS=Mus musculus OX=10090 GN=Arf1 PE=1 SV=2
10	P84079	7.52e-70	224	181	0.179	0.569	ARF1_RAT ADP-ribosylation factor 1 OS=Rattus norvegicus OX=10116 GN=Arf1 PE=1 SV=2
11	P84080	7.52e-70	224	181	0.179	0.569	ARF1_BOVIN ADP-ribosylation factor 1 OS=Bos taurus OX=9913 GN=ARF1 PE=1 SV=2
12	P61204	2.11e-69	223	181	0.178	0.564	ARF3_HUMAN ADP-ribosylation factor 3 OS=Homo sapiens OX=9606 GN=ARF3 PE=1 SV=2
13	P61205	2.11e-69	223	181	0.178	0.564	ARF3_MOUSE ADP-ribosylation factor 3 OS=Mus musculus OX=10090 GN=Arf3 PE=2 SV=2
14	Q8BSL7	2.28e-69	223	181	0.178	0.564	ARF2_MOUSE ADP-ribosylation factor 2 OS=Mus musculus OX=10090 GN=Arf2 PE=1 SV=2
15	P36579	2.64e-69	223	180	0.181	0.578	ARF1_SCHPO ADP-ribosylation factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=arf1 PE=2 SV=2
16	Q803D1	3.55e-69	223	180	0.178	0.567	Q803D1_DANRE ADP-ribosylation factor OS=Danio rerio OX=7955 GN=wu:fb33e02 PE=1 SV=1
17	B5X3E2	8.96e-69	222	180	0.176	0.561	B5X3E2_SALSA ADP-ribosylation factor OS=Salmo salar OX=8030 GN=ARF1 PE=2 SV=1
18	O00909	9.58e-69	222	182	0.178	0.560	ARF1_DICDI ADP-ribosylation factor 1 OS=Dictyostelium discoideum OX=44689 GN=arfA PE=1 SV=3
19	Q9LYJ3	1.28e-68	221	188	0.178	0.543	Q9LYJ3_ARATH ADP-ribosylation factor OS=Arabidopsis thaliana OX=3702 GN=ARFA1B PE=1 SV=1
20	Q38D64	2.10e-68	221	182	0.174	0.549	Q38D64_TRYB2 ADP-ribosylation factor OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.4470 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00025 Arf	7.1e-68	239.0	ADP-ribosylation factor family
2	PF16366 CEBP_ZZ	30	16.2	Cytoplasmic polyadenylation element-binding protein ZZ domain
3	PF02388 FemAB	9.5e+02	10.0	FemAB family
4	PF00503 G-alpha	1.5e-06	39.3	G-protein alpha subunit
5	PF04670 Gtr1_RagA	0.16	22.9	Gtr1/RagA G protein conserved region
6	PF01926 MMR_HSR1	0.86	21.1	50S ribosome-binding GTPase
7	PF14447 Prok-RING_4	8.9	17.6	Prokaryotic RING finger family 4
8	PF00071 Ras	1.9e-08	45.6	Ras family
9	PF08477 Roc	2.5e-10	52.0	Ras of Complex, Roc, domain of DAPkinase
10	PF09439 SRPRB	3.3e-07	41.4	Signal recognition particle receptor beta subunit
11	PF00643 zf-B_box	0.001	30.5	B-box zinc finger
12	PF00097 zf-C3HC4	4.7	18.5	Zinc finger, C3HC4 type (RING finger)
13	PF13639 zf-RING_2	0.15	23.8	Ring finger domain
14	PF14634 zf-RING_5	0.0061	27.8	zinc-RING finger domain
15	PF13445 zf-RING_UBOX	0.008	27.5	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000004312

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000023594	0.762	Uncharacterized protein
2	61853.ENSNLEP00000022739	0.755	Ribosomal protein S27a
3	61853.ENSNLEP00000023276	0.755	Uncharacterized protein
4	61853.ENSNLEP00000022450	0.748	Uncharacterized protein
5	61853.ENSNLEP00000023098	0.748	Ubiquitin-conjugating enzyme E2D 3
6	61853.ENSNLEP00000012192	0.745	ADP-ribosylation factor GTPase activating protein 1
7	61853.ENSNLEP00000000115	0.732	Cytohesin 1
8	61853.ENSNLEP00000018323	0.727	Golgi brefeldin A resistant guanine nucleotide exchange factor 1
9	61853.ENSNLEP00000014947	0.712	Ubiquitin-conjugating enzyme E2D 1
10	61853.ENSNLEP00000020785	0.689	MON2 homolog, regulator of endosome-to-Golgi trafficking
11	61853.ENSNLEP00000005467	0.685	Uncharacterized protein
12	61853.ENSNLEP00000021815	0.665	Leucine-rich repeat kinase 2
13	61853.ENSNLEP00000017414	0.653	ADP-ribosylation factor GTPase activating protein 2
14	61853.ENSNLEP00000019447	0.653	ADP-ribosylation factor GTPase activating protein 3
15	61853.ENSNLEP00000024460	0.651	annotation not available
16	61853.ENSNLEP00000021485	0.640	Coatomer subunit beta
17	61853.ENSNLEP00000020707	0.611	TANK-binding kinase 1
18	61853.ENSNLEP00000004110	0.609	Uncharacterized protein
19	61853.ENSNLEP00000022021	0.609	Ubiquitin-conjugating enzyme E2D 2
20	61853.ENSNLEP00000018428	0.607	DnaJ (Hsp40) homolog, subfamily C, member 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0005525	0.997	GTP binding
GO:0003824	0.990	catalytic activity
GO:0140096	0.977	catalytic activity, acting on a protein
GO:0004842	0.966	ubiquitin-protein transferase activity
GO:0003924	0.964	GTPase activity
GO:0019003	0.903	GDP binding
GO:0030234	0.882	enzyme regulator activity
GO:0042802	0.752	identical protein binding
GO:0008047	0.394	enzyme activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.989	organic substance metabolic process
GO:0044238	0.986	primary metabolic process
GO:0006807	0.979	nitrogen compound metabolic process
GO:0043170	0.966	macromolecule metabolic process
GO:0065007	0.924	biological regulation
GO:1901564	0.923	organonitrogen compound metabolic process
GO:0019538	0.903	protein metabolic process
GO:0050789	0.889	regulation of biological process
GO:0070647	0.857	protein modification by small protein conjugation or removal
GO:0032446	0.834	protein modification by small protein conjugation
GO:0009987	0.666	cellular process
GO:0016567	0.626	protein ubiquitination
GO:0019222	0.598	regulation of metabolic process
GO:0050794	0.563	regulation of cellular process
GO:0060255	0.483	regulation of macromolecule metabolic process
GO:0048518	0.467	positive regulation of biological process
GO:0051171	0.456	regulation of nitrogen compound metabolic process
GO:0080090	0.453	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.966	endomembrane system
GO:0005634	0.962	nucleus
GO:0016020	0.945	membrane
GO:0031090	0.775	organelle membrane
GO:0005794	0.568	Golgi apparatus
GO:0098588	0.556	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.966	Transferases.
RHEA:19669	0.964	GTP + H2O = GDP + H(+) + phosphate

[back to server]