StarFunc result for job id P36542

User Input

>input (298 residues)
MFSRAGVAGLSAWTLQPQWIQVRNMATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAE
RELKPARIYGLGSLALYEKADIKGPEDKKKHLLIGVSSDRGLCGAIHSSIAKQMKSEVAT
LTAAGKEVMLVGIGDKIRGILYRTHSDQFLVAFKEVGRKPPTFGDASVIALELLNSGYEF
DEGSIIFNKFRSVISYKTEEKPIFSLNTVASADSMSIYDDIDADVLQNYQEYNLANIIYY
SLKESTTSEQSARMTAMDNASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAALD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P05631	0.963	0.963	1.320E-47	298	0.919	0.919	P05631.pdb.gz	ATPG_BOVIN ATP synthase subunit gamma, mitochondrial OS=Bos taurus OX=9913 GN=ATP5F1C PE=1 SV=3
2	AFDB:P35435	0.912	0.996	4.680E-43	273	0.836	0.912	P35435.pdb.gz	ATPG_RAT ATP synthase subunit gamma, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5f1c PE=1 SV=2
3	PDB:6tt7G	0.877	0.958	6.483E-36	272	0.832	0.912	6tt7G.pdb.gz	Cryo-EM structure of the entire mammalian F-type ATP synthase.
4	AFDB:O01666	0.898	0.901	2.884E-33	297	0.540	0.542	O01666.pdb.gz	ATPG_DROME ATP synthase subunit gamma, mitochondrial OS=Drosophila melanogaster OX=7227 GN=ATPsyngamma PE=2 SV=2
5	PDB:1h8eG	0.778	0.944	6.889E-30	244	0.745	0.910	1h8eG.pdb.gz	Structure of Bovine Mitochondrial F1-ATPase with Nucleotide Bound to All Three Catalytic Sites: Implications for the Mechanism of Rotary Catalysis
6	AFDB:A0A1D8PRY3	0.902	0.914	4.032E-27	294	0.383	0.388	A0A1D8PRY3.pdb.gz	A0A1D8PRY3_CANAL ATP synthase subunit gamma OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ATP3 PE=3 SV=1
7	AFDB:O74754	0.853	0.845	2.463E-26	301	0.346	0.342	O74754.pdb.gz	ATPG_SCHPO ATP synthase subunit gamma, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atp3 PE=3 SV=1
8	AFDB:P38077	0.870	0.835	1.874E-25	311	0.376	0.360	P38077.pdb.gz	ATPG_YEAST ATP synthase subunit gamma, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATP3 PE=1 SV=1
9	PDB:4yxwG	0.685	0.951	4.981E-25	213	0.658	0.920	4yxwG.pdb.gz	How release of phosphate from mammalian F1-ATPase generates a rotary substep.
10	AFDB:Q96250	0.832	0.766	2.754E-24	325	0.349	0.320	Q96250.pdb.gz	ATPG3_ARATH ATP synthase subunit gamma, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ATPC PE=1 SV=1
11	PDB:2xokG	0.815	0.912	7.740E-23	265	0.362	0.408	2xokG.pdb.gz	Molecular architecture of the rotary motor in ATP synthase.
12	AFDB:Q8I6T7	0.834	0.801	3.080E-22	311	0.352	0.338	Q8I6T7.pdb.gz	Q8I6T7_PLAF7 ATP synthase subunit gamma OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1311300 PE=3 SV=1
13	PDB:2jizG	0.620	0.953	4.729E-22	192	0.591	0.917	2jizG.pdb.gz	Mechanism of Inhibition of Bovine F1-ATPase by Resveratrol and Related Polyphenols.
14	AFDB:Q54DF1	0.831	0.810	1.513E-20	306	0.322	0.314	Q54DF1.pdb.gz	ATPG_DICDI ATP synthase subunit gamma, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=atp5f1c PE=1 SV=1
15	AFDB:A1KI97	0.775	0.758	1.515E-18	305	0.302	0.295	A1KI97.pdb.gz	ATPG_MYCBP ATP synthase gamma chain OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) OX=410289 GN=atpG PE=3 SV=1
16	PDB:2jj1G	0.536	0.945	2.748E-16	167	0.520	0.928	2jj1G.pdb.gz	Mechanism of Inhibition of Bovine F1-ATPase by Resveratrol and Related Polyphenols.
17	PDB:6f5dG	0.741	0.794	5.607E-16	277	0.225	0.242	6f5dG.pdb.gz	ATP synthase fromTrypanosoma bruceihas an elaborated canonical F1-domain and conventional catalytic sites.
18	PDB:3oaaG	0.741	0.775	7.792E-16	284	0.265	0.278	3oaaG.pdb.gz	Structural basis for inhibition of bacterial ATP synthase by subunit epsilon of the rotor stalk
19	PDB:2w6gG	0.438	0.907	7.830E-11	140	0.446	0.950	2w6gG.pdb.gz
20	PDB:1mabG	0.366	0.820	4.304E-6	124	0.393	0.944	1mabG.pdb.gz	The 2.8-A structure of rat liver F1-ATPase: configuration of a critical intermediate in ATP synthesis/hydrolysis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P05631	0.0	575	298	0.919	0.919	ATPG_BOVIN ATP synthase subunit gamma, mitochondrial OS=Bos taurus OX=9913 GN=ATP5F1C PE=1 SV=3
2	P35435	0.0	520	273	0.836	0.912	ATPG_RAT ATP synthase subunit gamma, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5f1c PE=1 SV=2
3	P36542	0.0	610	298	1.000	1.000	ATPG_HUMAN ATP synthase subunit gamma, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1C PE=1 SV=1
4	Q91VR2	0.0	573	298	0.913	0.913	ATPG_MOUSE ATP synthase subunit gamma, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1c PE=1 SV=1
5	O01666	3.48e-113	330	297	0.550	0.552	ATPG_DROME ATP synthase subunit gamma, mitochondrial OS=Drosophila melanogaster OX=7227 GN=ATPsyngamma PE=2 SV=2
6	A0A1D8PRY3	2.90e-63	203	294	0.366	0.371	A0A1D8PRY3_CANAL ATP synthase subunit gamma OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ATP3 PE=3 SV=1
7	P38077	4.23e-60	196	311	0.376	0.360	ATPG_YEAST ATP synthase subunit gamma, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATP3 PE=1 SV=1
8	O74754	1.66e-59	194	301	0.352	0.349	ATPG_SCHPO ATP synthase subunit gamma, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atp3 PE=3 SV=1
9	Q96250	5.92e-54	180	325	0.356	0.326	ATPG3_ARATH ATP synthase subunit gamma, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ATPC PE=1 SV=1
10	Q8I6T7	8.42e-47	161	311	0.346	0.331	Q8I6T7_PLAF7 ATP synthase subunit gamma OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1311300 PE=3 SV=1
11	Q54DF1	2.68e-43	152	306	0.322	0.314	ATPG_DICDI ATP synthase subunit gamma, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=atp5f1c PE=1 SV=1
12	P09222	1.89e-32	123	286	0.326	0.339	ATPG_BACP3 ATP synthase gamma chain OS=Bacillus sp. (strain PS3) OX=2334 GN=atpG PE=1 SV=1
13	A1KI97	6.30e-31	119	305	0.329	0.321	ATPG_MYCBP ATP synthase gamma chain OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) OX=410289 GN=atpG PE=3 SV=1
14	P9WPU9	6.30e-31	119	305	0.329	0.321	ATPG_MYCTU ATP synthase gamma chain OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=atpG PE=1 SV=1
15	P17253	9.85e-29	114	314	0.329	0.312	ATPG_SYNY3 ATP synthase gamma chain OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=atpG PE=3 SV=1
16	P0ABA6	5.71e-28	111	287	0.315	0.328	ATPG_ECOLI ATP synthase gamma chain OS=Escherichia coli (strain K12) OX=83333 GN=atpG PE=1 SV=1
17	Q72E03	1.58e-27	110	291	0.295	0.302	ATPG_DESVH ATP synthase gamma chain OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=atpG PE=1 SV=1
18	Q01909	4.51e-27	110	386	0.332	0.256	ATPG2_ARATH ATP synthase gamma chain 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ATPC2 PE=2 SV=1
19	Q01908	1.91e-25	106	373	0.332	0.265	ATPG1_ARATH ATP synthase gamma chain 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ATPC1 PE=1 SV=1
20	Q38CM0	2.34e-12	68.6	305	0.248	0.243	Q38CM0_TRYB2 ATP synthase F1 subunit gamma protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.100.0070 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13291 ACT_4	1.4e+02	14.5	ACT domain
2	PF00231 ATP-synt	1.1e-75	266.6	ATP synthase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349142

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000215375	0.999	ATP synthase subunit delta, mitochondrial
2	9606.ENSP00000243997	0.999	ATP synthase subunit epsilon, mitochondrial
3	9606.ENSP00000262030	0.999	ATP synthase subunit beta, mitochondrial
4	9606.ENSP00000290299	0.999	ATP synthase subunit O, mitochondrial
5	9606.ENSP00000301587	0.999	ATP synthase subunit d, mitochondrial
6	9606.ENSP00000358737	0.999	ATP synthase F(0) complex subunit B1, mitochondrial
7	9606.ENSP00000377033	0.999	ATP synthase F(0) complex subunit C1, mitochondrial
8	9606.ENSP00000381736	0.999	ATP synthase subunit alpha, mitochondrial
9	9606.ENSP00000292475	0.998	ATP synthase subunit f, mitochondrial
10	9606.ENSP00000300688	0.998	ATP synthase subunit g, mitochondrial
11	9606.ENSP00000306003	0.998	ATP synthase subunit e, mitochondrial
12	9606.ENSP00000389649	0.998	ATP synthase-coupling factor 6, mitochondrial
13	9606.ENSP00000354632	0.997	ATP synthase subunit a
14	9606.ENSP00000284727	0.996	ATP synthase F(0) complex subunit C3, mitochondrial
15	9606.ENSP00000268379	0.988	Cytochrome b-c1 complex subunit 2, mitochondrial
16	9606.ENSP00000377878	0.986	ATP synthase F(0) complex subunit C2, mitochondrial
17	9606.ENSP00000355265	0.985	ATP synthase protein 8
18	9606.ENSP00000356972	0.984	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial
19	9606.ENSP00000392709	0.983	NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
20	9606.ENSP00000394107	0.983	annotation not available

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0003824	0.992	catalytic activity
GO:0022857	0.908	transmembrane transporter activity
GO:0016874	0.872	ligase activity
GO:0022803	0.807	passive transmembrane transporter activity
GO:0015078	0.756	proton transmembrane transporter activity
GO:0015252	0.712	proton channel activity
GO:0097159	0.367	organic cyclic compound binding
GO:1901363	0.357	heterocyclic compound binding
GO:0046933	0.321	proton-transporting ATP synthase activity, rotational mechanism

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.981	cellular metabolic process
GO:0071704	0.974	organic substance metabolic process
GO:0009060	0.963	aerobic respiration
GO:0044238	0.959	primary metabolic process
GO:0044271	0.955	cellular nitrogen compound biosynthetic process
GO:0009165	0.952	nucleotide biosynthetic process
GO:0006119	0.935	oxidative phosphorylation
GO:1901566	0.917	organonitrogen compound biosynthetic process
GO:0009145	0.915	purine nucleoside triphosphate biosynthetic process
GO:0009260	0.880	ribonucleotide biosynthetic process
GO:0006164	0.876	purine nucleotide biosynthetic process
GO:0009152	0.857	purine ribonucleotide biosynthetic process
GO:0006754	0.851	ATP biosynthetic process
GO:0015986	0.821	proton motive force-driven ATP synthesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005743	0.999	mitochondrial inner membrane
GO:1902494	0.998	catalytic complex
GO:0098796	0.998	membrane protein complex
GO:0070013	0.993	intracellular organelle lumen
GO:0098800	0.992	inner mitochondrial membrane protein complex
GO:0016469	0.967	proton-transporting two-sector ATPase complex
GO:0045259	0.954	proton-transporting ATP synthase complex
GO:0005753	0.848	mitochondrial proton-transporting ATP synthase complex
GO:0005759	0.593	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.-.-.-	0.872	Ligases.
RHEA:57720	0.321	ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate
EC:7.1.2.2	0.321	H(+)-transporting two-sector ATPase.

[back to server]