StarFunc result for job id P36544

User Input

>input (502 residues)
MRCSPGGVWLALAASLLHVSLQGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLL
QIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADE
RFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDL
QMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIP
CVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFAST
MIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHK
QRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHL
LHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTI
ICTIGILMSAPNFVEAVSKDFA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P36544	1.000	1.000	8.574E-90	502	1.000	1.000	P36544.pdb.gz	ACHA7_HUMAN Neuronal acetylcholine receptor subunit alpha-7 OS=Homo sapiens OX=9606 GN=CHRNA7 PE=1 SV=5
2	AFDB:F1P4Y5	0.852	0.852	1.793E-82	502	0.896	0.896	F1P4Y5.pdb.gz
3	AFDB:A0A0R4IV47	0.855	0.842	5.171E-75	510	0.761	0.749	A0A0R4IV47.pdb.gz
4	AFDB:Q03481	0.832	0.818	3.527E-70	511	0.681	0.669	Q03481.pdb.gz	Q03481_CHICK Alpha8 subunit of nicotinic acetylcholine receptor OS=Gallus gallus OX=9031 GN=CHRNA8 PE=2 SV=1
5	AFDB:E1JJR2	0.792	0.707	3.637E-56	564	0.484	0.431	E1JJR2.pdb.gz	E1JJR2_DROME Nicotinic acetylcholine receptor alpha7, isoform E OS=Drosophila melanogaster OX=7227 GN=nAChRalpha7 PE=3 SV=1
6	AFDB:Q7KT97	0.786	0.493	3.819E-53	808	0.480	0.298	Q7KT97.pdb.gz	Q7KT97_DROME Nicotinic acetylcholine receptor alpha5, isoform B OS=Drosophila melanogaster OX=7227 GN=nAChRalpha5 PE=3 SV=1
7	AFDB:Q7KTF7	0.797	0.786	1.377E-51	509	0.454	0.448	Q7KTF7.pdb.gz	Q7KTF7_DROME Nicotinic acetylcholine receptor alpha6, isoform D OS=Drosophila melanogaster OX=7227 GN=nAChRalpha6 PE=3 SV=1
8	AFDB:Q7KTF8	0.795	0.763	1.800E-51	523	0.464	0.446	Q7KTF8.pdb.gz	Q7KTF8_DROME Nicotinic acetylcholine receptor alpha6, isoform E OS=Drosophila melanogaster OX=7227 GN=nAChRalpha6 PE=3 SV=1
9	AFDB:P48180	0.793	0.799	2.113E-51	498	0.442	0.446	P48180.pdb.gz	ACH1_CAEEL Acetylcholine receptor subunit alpha-type acr-16 OS=Caenorhabditis elegans OX=6239 GN=acr-16 PE=2 SV=1
10	AFDB:Q9NFR5	0.760	0.675	7.223E-50	568	0.404	0.357	Q9NFR5.pdb.gz	Q9NFR5_DROME Nicotinic acetylcholine receptor Dalpha 4 subunit OS=Drosophila melanogaster OX=7227 GN=nAChRalpha4 PE=2 SV=1
11	PDB:6i53B	0.535	0.781	1.857E-21	338	0.139	0.207	6i53B.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
12	PDB:6i53A	0.527	0.746	1.497E-20	349	0.108	0.155	6i53A.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
13	PDB:4aq5E	0.497	0.653	1.956E-20	370	0.221	0.300	4aq5E.pdb.gz
14	PDB:4hfcA	0.490	0.771	4.357E-19	311	0.104	0.167	4hfcA.pdb.gz	Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
15	PDB:2w8gC	0.377	0.845	5.998E-18	217	0.108	0.249	2w8gC.pdb.gz	Use of Acetylcholine Binding Protein in the Search for Novel Alpha7 Nicotinic Receptor Ligands. In Silico Docking, Pharmacological Screening, and X- Ray Analysis.
16	PDB:7kuyE	0.458	0.662	2.166E-17	338	0.125	0.186	7kuyE.pdb.gz	Characterization of the subunit composition and structure of adult human glycine receptors
17	PDB:4afhA	0.360	0.821	4.826E-16	213	0.108	0.254	4afhA.pdb.gz	Molecular Actions of Smoking Cessation Drugs at Alpha4Beta2 Nicotinic Receptors Defined in Crystal Structures of a Homologous Binding Protein.
18	PDB:7l6qA	0.464	0.725	7.812E-16	311	0.118	0.190	7l6qA.pdb.gz	Structure and function at the lipid-protein interface of a pentameric ligand-gated ion channel.
19	PDB:6zgdA	0.441	0.743	9.114E-12	288	0.108	0.188	6zgdA.pdb.gz
20	PDB:5nzuD	0.074	0.081	1.056E-3	427	0.042	0.049	5nzuD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P22770	0.0	937	502	0.886	0.886	ACHA7_CHICK Neuronal acetylcholine receptor subunit alpha-7 OS=Gallus gallus OX=9031 GN=CHRNA7 PE=1 SV=1
2	P36544	0.0	1043	502	1.000	1.000	ACHA7_HUMAN Neuronal acetylcholine receptor subunit alpha-7 OS=Homo sapiens OX=9606 GN=CHRNA7 PE=1 SV=5
3	P49582	0.0	970	502	0.930	0.930	ACHA7_MOUSE Neuronal acetylcholine receptor subunit alpha-7 OS=Mus musculus OX=10090 GN=Chrna7 PE=1 SV=1
4	Q03481	0.0	687	511	0.681	0.669	Q03481_CHICK Alpha8 subunit of nicotinic acetylcholine receptor OS=Gallus gallus OX=9031 GN=CHRNA8 PE=2 SV=1
5	Q05941	0.0	970	502	0.930	0.930	ACHA7_RAT Neuronal acetylcholine receptor subunit alpha-7 OS=Rattus norvegicus OX=10116 GN=Chrna7 PE=1 SV=2
6	Q800C7	0.0	807	509	0.771	0.760	Q800C7_DANRE Neuronal acetylcholine receptor subunit alpha-7 OS=Danio rerio OX=7955 GN=chrna7 PE=2 SV=1
7	Q866A2	0.0	1035	502	0.990	0.990	ACHA7_MACMU Neuronal acetylcholine receptor subunit alpha-7 OS=Macaca mulatta OX=9544 GN=CHRNA7 PE=2 SV=1
8	Q86MN7	5.75e-167	484	542	0.482	0.446	Q86MN7_DROME Nicotinic acetylcholine receptor subunit Dalpha7 OS=Drosophila melanogaster OX=7227 GN=nAChRalpha7 PE=2 SV=1
9	Q9VWI9	4.88e-166	483	560	0.480	0.430	Q9VWI9_DROME Nicotinic acetylcholine receptor alpha7, isoform A OS=Drosophila melanogaster OX=7227 GN=nAChRalpha7 PE=3 SV=4
10	E1JJR2	5.16e-166	483	564	0.480	0.427	E1JJR2_DROME Nicotinic acetylcholine receptor alpha7, isoform E OS=Drosophila melanogaster OX=7227 GN=nAChRalpha7 PE=3 SV=1
11	Q7KT97	1.53e-164	488	808	0.490	0.304	Q7KT97_DROME Nicotinic acetylcholine receptor alpha5, isoform B OS=Drosophila melanogaster OX=7227 GN=nAChRalpha5 PE=3 SV=1
12	Q8T7V5	8.28e-164	486	807	0.488	0.304	Q8T7V5_DROME Nicotinic acetylcholine receptor Dalpha5 subunit OS=Drosophila melanogaster OX=7227 GN=nAChRalpha5 PE=2 SV=1
13	M9PFD8	1.07e-159	464	494	0.474	0.482	M9PFD8_DROME Nicotinic acetylcholine receptor alpha6, isoform H OS=Drosophila melanogaster OX=7227 GN=nAChRalpha6 PE=3 SV=1
14	Q7KTF9	7.21e-159	462	494	0.472	0.480	Q7KTF9_DROME Nicotinic acetylcholine receptor alpha6, isoform B OS=Drosophila melanogaster OX=7227 GN=nAChRalpha6 PE=3 SV=1
15	Q8T7S2	3.49e-158	460	494	0.470	0.478	Q8T7S2_DROME Nicotinic acetylcholine receptor Dalpha6 subunit variant type II OS=Drosophila melanogaster OX=7227 GN=nAChRalpha6 PE=2 SV=1
16	Q9VL79	7.64e-158	459	494	0.466	0.474	Q9VL79_DROME Nicotinic acetylcholine receptor Dalpha6 subunit variant type I OS=Drosophila melanogaster OX=7227 GN=nAChRalpha6 PE=2 SV=3
17	Q86MN8	1.95e-157	458	494	0.470	0.478	Q86MN8_DROME Nicotinic acetylcholine receptor subunit Dalpha6 OS=Drosophila melanogaster OX=7227 GN=nAChRalpha6 PE=2 SV=1
18	Q8T7S1	3.47e-157	458	494	0.464	0.472	Q8T7S1_DROME Nicotinic acetylcholine receptor Dalpha6 subunit variant type III OS=Drosophila melanogaster OX=7227 GN=nAChRalpha6 PE=2 SV=1
19	Q8IPE2	3.82e-157	457	494	0.464	0.472	Q8IPE2_DROME Nicotinic acetylcholine receptor alpha6, isoform C OS=Drosophila melanogaster OX=7227 GN=nAChRalpha6 PE=3 SV=2
20	Q7KTF7	2.52e-154	451	509	0.466	0.460	Q7KTF7_DROME Nicotinic acetylcholine receptor alpha6, isoform D OS=Drosophila melanogaster OX=7227 GN=nAChRalpha6 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02931 Neur_chan_LBD	8.7e-70	246.1	Neurotransmitter-gated ion-channel ligand binding domain
2	PF02932 Neur_chan_memb	6.9e-59	211.3	Neurotransmitter-gated ion-channel transmembrane region
3	PF06687 SUR7	8.4e+02	11.0	SUR7/PalI family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003826096.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003823415.1	0.939	Janus kinase 2
2	9597.XP_003819529.1	0.873	Secreted LY6/PLAUR domain containing 1
3	9597.XP_003817157.1	0.763	Neuronal acetylcholine receptor subunit beta-2
4	9597.XP_003813864.1	0.709	Neuronal acetylcholine receptor subunit beta-4 isoform X1
5	9597.XP_003817043.1	0.686	Glutamate receptor ionotropic, NMDA 1 isoform X1
6	9597.XP_003823324.1	0.681	Cholinergic receptor nicotinic alpha 6 subunit
7	9597.XP_008961474.1	0.671	Basic helix-loop-helix family member e23
8	9597.XP_008964672.1	0.661	Neuronal acetylcholine receptor subunit alpha-5
9	9597.XP_008960066.1	0.660	Myotubularin-related protein 10 isoform X1
10	9597.XP_008964673.1	0.658	Neuronal acetylcholine receptor subunit alpha-3
11	9597.XP_003829825.1	0.655	Activating transcription factor 6 beta
12	9597.XP_003823326.1	0.652	Cholinergic receptor nicotinic beta 3 subunit
13	9597.XP_008976455.1	0.646	Cholinergic receptor muscarinic 3
14	9597.XP_003809953.1	0.644	Neuronal acetylcholine receptor subunit alpha-4
15	9597.XP_003830852.1	0.642	Cholinergic receptor nicotinic alpha 2 subunit
16	9597.XP_008976306.1	0.641	Acetylcholine receptor subunit alpha
17	9597.XP_008971092.1	0.631	Ly6/neurotoxin 1
18	9597.XP_003808342.1	0.623	Glutamate ionotropic receptor NMDA type subunit 2A
19	9597.XP_003832257.1	0.618	Cholinergic receptor nicotinic alpha 9 subunit
20	9597.XP_008958356.1	0.601	Belongs to the ligand-gated ion channel (TC 1.A.9) family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0022848	0.999	acetylcholine-gated monoatomic cation-selective channel activity
GO:0005515	0.995	protein binding
GO:0004888	0.994	transmembrane signaling receptor activity
GO:0015464	0.912	acetylcholine receptor activity
GO:0015318	0.899	inorganic molecular entity transmembrane transporter activity
GO:0043169	0.691	cation binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.989	response to stimulus
GO:0065008	0.986	regulation of biological quality
GO:0009987	0.985	cellular process
GO:0032501	0.980	multicellular organismal process
GO:0007154	0.980	cell communication
GO:0023052	0.979	signaling
GO:0042391	0.962	regulation of membrane potential
GO:0051899	0.945	membrane depolarization
GO:0050890	0.936	cognition
GO:0050794	0.919	regulation of cellular process
GO:0042221	0.918	response to chemical
GO:0035094	0.890	response to nicotine
GO:0051179	0.839	localization
GO:0051716	0.781	cellular response to stimulus
GO:0010646	0.776	regulation of cell communication
GO:0007610	0.742	behavior
GO:0099536	0.727	synaptic signaling
GO:0007165	0.723	signal transduction
GO:0023051	0.707	regulation of signaling
GO:0007268	0.671	chemical synaptic transmission
GO:0051234	0.670	establishment of localization
GO:0006810	0.655	transport
GO:0006811	0.588	monoatomic ion transport
GO:0007271	0.505	synaptic transmission, cholinergic
GO:0007611	0.480	learning or memory
GO:0048518	0.414	positive regulation of biological process
GO:0009966	0.406	regulation of signal transduction
GO:0048519	0.390	negative regulation of biological process
GO:0010033	0.384	response to organic substance
GO:0019222	0.366	regulation of metabolic process
GO:0032502	0.365	developmental process
GO:0006812	0.339	monoatomic cation transport
GO:0060255	0.336	regulation of macromolecule metabolic process
GO:0048856	0.325	anatomical structure development
GO:0048522	0.318	positive regulation of cellular process
GO:0034220	0.306	monoatomic ion transmembrane transport
GO:0048523	0.301	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0034702	0.997	ion channel complex
GO:0097060	0.996	synaptic membrane
GO:0098802	0.995	plasma membrane signaling receptor complex
GO:0005737	0.987	cytoplasm
GO:0043226	0.985	organelle
GO:0045211	0.977	postsynaptic membrane
GO:0005892	0.973	acetylcholine-gated channel complex
GO:0043005	0.963	neuron projection
GO:0098793	0.957	presynapse
GO:0042734	0.946	presynaptic membrane
GO:0036477	0.803	somatodendritic compartment
GO:0099572	0.798	postsynaptic specialization
GO:0098978	0.702	glutamatergic synapse
GO:0099634	0.701	postsynaptic specialization membrane
GO:0043227	0.663	membrane-bounded organelle
GO:0043231	0.568	intracellular membrane-bounded organelle
GO:0012505	0.362	endomembrane system
GO:0097447	0.355	dendritic tree
GO:0030424	0.344	axon
GO:0030425	0.343	dendrite
GO:0044297	0.336	cell body
GO:0031981	0.307	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]