StarFunc result for job id P36776

User Input

>input (959 residues)
MAASTGYVRLWGAARCWVLRRPMLAAAGGRVPTAAGAWLLRGQRTCDASPPWALWGRGPA
IGGQWRGFWEASSRGGGAFSGGEDASEGGAEEGAGGAGGSAGAGEGPVITALTPMTIPDV
FPHLPLIAITRNPVFPRFIKIIEVKNKKLVELLRRKVRLAQPYVGVFLKRDDSNESDVVE
SLDEIYHTGTFAQIHEMQDLGDKLRMIVMGHRRVHISRQLEVEPEEPEAENKHKPRRKSK
RGKKEAEDELSARHPAELAMEPTPELPAEVLMVEVENVVHEDFQVTEEVKALTAEIVKTI
RDIIALNPLYRESVLQMMQAGQRVVDNPIYLSDMGAALTGAESHELQDVLEETNIPKRLY
KALSLLKKEFELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEK
FRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSNENLDL
ARAQAVLEEDHYGMEDVKKRILEFIAVSQLRGSTQGKILCFYGPPGVGKTSIARSIARAL
NREYFRFSVGGMTDVAEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEVDKIGRGYQ
GDPSSALLELLDPEQNANFLDHYLDVPVDLSKVLFICTANVTDTIPEPLRDRMEMINVSG
YVAQEKLAIAERYLVPQARALCGLDESKAKLSSDVLTLLIKQYCRESGVRNLQKQVEKVL
RKSAYKIVSGEAESVEVTPENLQDFVGKPVFTVERMYDVTPPGVVMGLAWTAMGGSTLFV
ETSLRRPQDKDAKGDKDGSLEVTGQLGEVMKESARIAYTFARAFLMQHAPANDYLVTSHI
HLHVPEGATPKDGPSAGCTIVTALLSLAMGRPVRQNLAMTGEVSLTGKILPVGGIKEKTI
AAKRAGVTCIVLPAENKKDFYDLAAFITEGLEVHFVEHYREIFDIAFPDEQAEALAVER

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7oxoA	0.546	0.669	0.000	776	0.808	0.999	7oxoA.pdb.gz	Catalytic cycling of human mitochondrial Lon protease.
2	AFDB:P36775	0.550	0.467	0.000	1133	0.432	0.365	P36775.pdb.gz	LONM_YEAST Lon protease homolog, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PIM1 PE=1 SV=2
3	AFDB:Q09769	0.674	0.612	0.000	1067	0.430	0.386	Q09769.pdb.gz	LONM_SCHPO Lon protease homolog, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pim1 PE=3 SV=1
4	AFDB:Q59HJ6	0.866	0.864	0.000	961	0.922	0.920	Q59HJ6.pdb.gz	LONM_BOVIN Lon protease homolog, mitochondrial OS=Bos taurus OX=9913 GN=LONP1 PE=1 SV=1
5	AFDB:Q9I5F9	0.561	0.672	5.988E-95	799	0.369	0.443	Q9I5F9.pdb.gz	Q9I5F9_PSEAE Lon protease OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=lon PE=2 SV=1
6	PDB:7p09F	0.498	0.879	4.665E-84	520	0.541	0.998	7p09F.pdb.gz	A dual allosteric pathway drives human mitochondrial Lon
7	AFDB:A0A059VAZ3	0.539	0.649	3.426E-81	793	0.318	0.385	A0A059VAZ3.pdb.gz	A0A059VAZ3_9DEIN Lon protease OS=Meiothermus taiwanensis OX=172827 GN=lonA1 PE=1 SV=1
8	AFDB:Q3MIB4	0.525	0.588	3.708E-76	852	0.297	0.335	Q3MIB4.pdb.gz	LONP2_RAT Lon protease homolog 2, peroxisomal OS=Rattus norvegicus OX=10116 GN=Lonp2 PE=1 SV=2
9	AFDB:O64948	0.527	0.567	2.392E-74	888	0.297	0.321	O64948.pdb.gz	LONP2_ARATH Lon protease homolog 2, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=LON2 PE=2 SV=1
10	AFDB:P93647	0.509	0.549	3.868E-74	885	0.303	0.329	P93647.pdb.gz	LONP2_MAIZE Lon protease homolog 2, peroxisomal OS=Zea mays OX=4577 GN=LON1 PE=2 SV=1
11	PDB:7fd4B	0.515	0.625	4.341E-71	779	0.318	0.392	7fd4B.pdb.gz	Complete three-dimensional structures of the Lon protease translocating a protein substrate.
12	PDB:6u5zA	0.516	0.911	9.960E-57	529	0.241	0.437	6u5zA.pdb.gz
13	AFDB:Q6TXI3	0.415	0.479	5.023E-44	806	0.214	0.254	Q6TXI3.pdb.gz	Q6TXI3_RAT LRRGT00016 OS=Rattus norvegicus OX=10116 GN=Lonp2 PE=1 SV=1
14	PDB:8a8wD	0.230	0.369	9.559E-11	577	0.067	0.111	8a8wD.pdb.gz	Structure of the drug target ClpC1 unfoldase in action provides insights on antibiotic mechanism of action.
15	PDB:6w6jD	0.239	0.317	9.011E-10	707	0.075	0.102	6w6jD.pdb.gz	Structural basis for aggregate dissolution and refolding by the Mycobacterium tuberculosis ClpB-DnaK bi-chaperone system.
16	PDB:6qs6C	0.235	0.345	9.506E-10	630	0.072	0.110	6qs6C.pdb.gz	Two-Step Activation Mechanism of the ClpB Disaggregase for Sequential Substrate Threading by the Main ATPase Motor.
17	PDB:1ksfX	0.218	0.284	1.310E-9	714	0.060	0.081	1ksfX.pdb.gz	Crystal structure of ClpA, an HSP100 chaperone and regulator of ClpAP protease
18	PDB:6qs6B	0.247	0.394	1.310E-9	582	0.070	0.115	6qs6B.pdb.gz	Two-Step Activation Mechanism of the ClpB Disaggregase for Sequential Substrate Threading by the Main ATPase Motor.
19	PDB:6w6hC	0.230	0.338	2.235E-9	636	0.082	0.124	6w6hC.pdb.gz	Structural basis for aggregate dissolution and refolding by the Mycobacterium tuberculosis ClpB-DnaK bi-chaperone system.
20	AFDB:Q08562	0.068	0.044	2.097E-2	1619	0.081	0.048	Q08562.pdb.gz	ULS1_YEAST ATP-dependent helicase ULS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ULS1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	K7EJE8	0.0	1686	829	0.864	1.000	K7EJE8_HUMAN Lon protease homolog, mitochondrial OS=Homo sapiens OX=9606 GN=LONP1 PE=1 SV=1
2	K7EKE6	0.0	1728	845	0.881	1.000	K7EKE6_HUMAN Lon protease homolog, mitochondrial OS=Homo sapiens OX=9606 GN=LONP1 PE=1 SV=1
3	O44952	0.0	914	971	0.496	0.490	LONM_CAEEL Lon protease homolog, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=lonp-1 PE=3 SV=1
4	P36775	0.0	780	1133	0.432	0.365	LONM_YEAST Lon protease homolog, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PIM1 PE=1 SV=2
5	P36776	0.0	1968	959	1.000	1.000	LONM_HUMAN Lon protease homolog, mitochondrial OS=Homo sapiens OX=9606 GN=LONP1 PE=1 SV=2
6	P93655	0.0	838	940	0.462	0.471	LONM1_ARATH Lon protease homolog 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=LON1 PE=1 SV=2
7	Q09769	0.0	803	1067	0.437	0.393	LONM_SCHPO Lon protease homolog, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pim1 PE=3 SV=1
8	Q59HJ6	0.0	1768	961	0.923	0.921	LONM_BOVIN Lon protease homolog, mitochondrial OS=Bos taurus OX=9913 GN=LONP1 PE=1 SV=1
9	Q7KUT2	0.0	1095	1024	0.584	0.547	LONM_DROME Lon protease homolog, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Lon PE=1 SV=1
10	Q8CGK3	0.0	1702	949	0.877	0.886	LONM_MOUSE Lon protease homolog, mitochondrial OS=Mus musculus OX=10090 GN=Lonp1 PE=1 SV=2
11	Q924S5	0.0	1726	950	0.885	0.894	LONM_RAT Lon protease homolog, mitochondrial OS=Rattus norvegicus OX=10116 GN=Lonp1 PE=2 SV=1
12	Q9I5F9	0.0	659	799	0.371	0.446	Q9I5F9_PSEAE Lon protease OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=lon PE=2 SV=1
13	Q9M9L7	0.0	775	942	0.449	0.458	LONM4_ARATH Lon protease homolog 4, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=LON4 PE=3 SV=1
14	Q9M9L8	0.0	688	924	0.410	0.425	LONM3_ARATH Lon protease homolog 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=LON3 PE=3 SV=1
15	A0A059VAZ3	3.42e-173	526	793	0.292	0.353	A0A059VAZ3_9DEIN Lon protease OS=Meiothermus taiwanensis OX=172827 GN=lonA1 PE=1 SV=1
16	P0A9M0	5.96e-166	506	784	0.272	0.333	LON_ECOLI Lon protease OS=Escherichia coli (strain K12) OX=83333 GN=lon PE=1 SV=1
17	K7ER27	4.46e-165	484	242	0.251	0.996	K7ER27_HUMAN Lon peptidase 1, mitochondrial (Fragment) OS=Homo sapiens OX=9606 GN=LONP1 PE=1 SV=1
18	Q9I2T9	1.14e-161	496	798	0.277	0.333	Q9I2T9_PSEAE Lon protease OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=lon PE=2 SV=1
19	P93647	4.05e-150	469	885	0.288	0.312	LONP2_MAIZE Lon protease homolog 2, peroxisomal OS=Zea mays OX=4577 GN=LON1 PE=2 SV=1
20	Q3MIB4	1.58e-149	466	852	0.249	0.281	LONP2_RAT Lon protease homolog 2, peroxisomal OS=Rattus norvegicus OX=10116 GN=Lonp2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	4.4e-21	87.1	ATPase family associated with various cellular activities (AAA)
2	PF13173 AAA_14	0.89	21.0	AAA domain
3	PF13191 AAA_16	0.0084	28.0	AAA ATPase domain
4	PF13207 AAA_17	2.7e+02	13.4	AAA domain
5	PF13238 AAA_18	1.2e+02	14.7	AAA domain
6	PF07724 AAA_2	0.00051	31.7	AAA domain (Cdc48 subfamily)
7	PF13401 AAA_22	0.14	23.8	AAA domain
8	PF13476 AAA_23	3.1	19.8	AAA domain
9	PF13479 AAA_24	3.5e+02	12.3	AAA domain
10	PF07726 AAA_3	4.3e+02	12.2	ATPase family associated with various cellular activities (AAA)
11	PF07728 AAA_5	2e-05	36.0	AAA domain (dynein-related subfamily)
12	PF12775 AAA_7	2.7e+02	12.5	P-loop containing dynein motor region
13	PF08298 AAA_PrkA	0.012	26.1	PrkA AAA domain
14	PF00005 ABC_tran	3.6e+02	13.1	ABC transporter
15	PF01637 ATPase_2	17	16.8	ATPase domain predominantly from Archaea
16	PF20030 bpMoxR	8.4	16.9	MoxR domain in the MoxR-vWA-beta-propeller ternary systems
17	PF13541 ChlI	0.0018	29.5	Subunit ChlI of Mg-chelatase
18	PF01695 IstB_IS21	2.6e+02	12.5	IstB-like ATP binding protein
19	PF05362 Lon_C	9.9e-66	232.7	Lon protease (S16) C-terminal proteolytic domain
20	PF02190 LON_substr_bdg	7.5e-28	109.3	ATP-dependent protease La (LON) substrate-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353826

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000245816	0.949	ATP-dependent Clp protease proteolytic subunit, mitochondrial
2	9606.ENSP00000300107	0.940	ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial
3	9606.ENSP00000373620	0.933	60 kDa heat shock protein, mitochondrial
4	9606.ENSP00000269143	0.928	AFG3-like protein 2
5	9606.ENSP00000318480	0.886	ATP-dependent zinc metalloprotease YME1L1
6	9606.ENSP00000216254	0.885	Aconitate hydratase, mitochondrial
7	9606.ENSP00000233627	0.856	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
8	9606.ENSP00000215567	0.812	Very-long-chain enoyl-CoA reductase
9	9606.ENSP00000268704	0.810	Paraplegin
10	9606.ENSP00000262375	0.799	DnaJ homolog subfamily A member 3, mitochondrial
11	9606.ENSP00000420588	0.798	Transcription factor A, mitochondrial
12	9606.ENSP00000364204	0.780	Serine/threonine-protein kinase PINK1, mitochondrial
13	9606.ENSP00000297185	0.776	Stress-70 protein, mitochondrial
14	9606.ENSP00000210313	0.768	26S proteasome non-ATPase regulatory subunit 5
15	9606.ENSP00000428426	0.727	Transcription elongation factor A protein 1
16	9606.ENSP00000232607	0.726	Uridine 5'-monophosphate synthase
17	9606.ENSP00000343515	0.726	Transcription elongation factor A protein 2
18	9606.ENSP00000294053	0.693	Caseinolytic peptidase B protein homolog
19	9606.ENSP00000441875	0.693	Prohibitin-2
20	9606.ENSP00000377747	0.688	Chromodomain-helicase-DNA-binding protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140657	1.000	ATP-dependent activity
GO:0005515	1.000	protein binding
GO:0008233	0.999	peptidase activity
GO:1901363	0.996	heterocyclic compound binding
GO:0097159	0.991	organic cyclic compound binding
GO:0004176	0.991	ATP-dependent peptidase activity
GO:0016817	0.976	hydrolase activity, acting on acid anhydrides
GO:0016887	0.965	ATP hydrolysis activity
GO:0003676	0.948	nucleic acid binding
GO:0003723	0.939	RNA binding
GO:0003677	0.880	DNA binding
GO:0043167	0.871	ion binding
GO:0000166	0.868	nucleotide binding
GO:0032559	0.863	adenyl ribonucleotide binding
GO:0043168	0.845	anion binding
GO:0005524	0.823	ATP binding
GO:0042802	0.769	identical protein binding
GO:0019899	0.746	enzyme binding
GO:0070182	0.703	DNA polymerase binding
GO:0043565	0.626	sequence-specific DNA binding
GO:0003727	0.593	single-stranded RNA binding
GO:1990837	0.576	sequence-specific double-stranded DNA binding
GO:0043531	0.437	ADP binding
GO:0001067	0.327	transcription regulatory region nucleic acid binding
GO:0051880	0.324	G-quadruplex DNA binding
GO:0000976	0.314	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0006807	0.993	nitrogen compound metabolic process
GO:0009987	0.989	cellular process
GO:0043170	0.988	macromolecule metabolic process
GO:1901564	0.981	organonitrogen compound metabolic process
GO:0044237	0.932	cellular metabolic process
GO:0019538	0.915	protein metabolic process
GO:0009056	0.850	catabolic process
GO:1901575	0.821	organic substance catabolic process
GO:0030163	0.789	protein catabolic process
GO:0006508	0.778	proteolysis
GO:0007005	0.693	mitochondrion organization
GO:0050896	0.517	response to stimulus
GO:0065007	0.347	biological regulation
GO:0051603	0.323	proteolysis involved in protein catabolic process
GO:0050789	0.310	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070013	0.999	intracellular organelle lumen
GO:0005739	0.999	mitochondrion
GO:0005759	0.989	mitochondrial matrix
GO:0031981	0.889	nuclear lumen
GO:0005654	0.866	nucleoplasm
GO:0016020	0.803	membrane
GO:0005829	0.552	cytosol
GO:0043232	0.512	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	0.999	Acting on peptide bonds (peptidases).
EC:3.6.-.-	0.976	Acting on acid anhydrides.
RHEA:13065	0.965	ATP + H2O = ADP + H(+) + phosphate

[back to server]