StarFunc result for job id P36873

User Input

>input (323 residues)
MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNATRPVTPPRGMITKQAKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P48727	0.927	0.899	2.799E-64	333	0.907	0.880	P48727.pdb.gz	GLC7B_CAEEL Serine/threonine-protein phosphatase PP1-beta OS=Caenorhabditis elegans OX=6239 GN=gsp-2 PE=1 SV=1
2	AFDB:A0A140VJS9	0.931	0.882	3.480E-63	341	0.932	0.883	A0A140VJS9.pdb.gz	A0A140VJS9_HUMAN Serine/threonine-protein phosphatase OS=Homo sapiens OX=9606 PE=2 SV=1
3	AFDB:Q59N42	0.961	0.941	1.025E-62	330	0.811	0.794	Q59N42.pdb.gz	Q59N42_CANAL Serine/threonine-protein phosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GLC7 PE=3 SV=1
4	AFDB:Q27497	0.931	0.914	1.469E-62	329	0.848	0.833	Q27497.pdb.gz	GLC7A_CAEEL Serine/threonine-protein phosphatase PP1-alpha OS=Caenorhabditis elegans OX=6239 GN=gsp-1 PE=1 SV=2
5	AFDB:Q7ZVR3	0.928	0.902	2.374E-62	332	0.916	0.892	Q7ZVR3.pdb.gz	Q7ZVR3_DANRE Serine/threonine-protein phosphatase OS=Danio rerio OX=7955 GN=zgc:76940 PE=1 SV=1
6	AFDB:P13681	0.926	0.915	8.369E-62	327	0.824	0.813	P13681.pdb.gz	PP11_SCHPO Serine/threonine-protein phosphatase PP1-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dis2 PE=1 SV=1
7	AFDB:P48461	0.923	0.912	2.465E-61	327	0.895	0.884	P48461.pdb.gz	PP11_DROME Serine/threonine-protein phosphatase alpha-1 isoform OS=Drosophila melanogaster OX=7227 GN=Pp1alpha-96A PE=1 SV=1
8	AFDB:F1QI59	0.930	0.919	3.751E-61	327	0.873	0.862	F1QI59.pdb.gz
9	AFDB:Q8ILV1	0.930	0.988	4.769E-61	304	0.789	0.839	Q8ILV1.pdb.gz	Q8ILV1_PLAF7 Serine/threonine-protein phosphatase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1414400 PE=1 SV=1
10	PDB:6zejI	0.905	0.833	1.780E-60	351	0.885	0.815	6zejI.pdb.gz	Molecular basis for substrate specificity of the Phactr1/PP1 phosphatase holoenzyme.
11	AFDB:P20654	0.936	0.936	4.663E-60	323	0.824	0.824	P20654.pdb.gz	PP1_EMENI Serine/threonine-protein phosphatase PP1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bimG PE=2 SV=1
12	PDB:1s70A	0.920	0.961	8.100E-58	309	0.858	0.896	1s70A.pdb.gz	Structural basis of protein phosphatase 1 regulation
13	PDB:2nppC	0.860	0.901	1.153E-38	308	0.440	0.461	2nppC.pdb.gz	Structure of the protein phosphatase 2A holoenzyme
14	PDB:7obeA	0.852	0.580	2.858E-33	480	0.344	0.231	7obeA.pdb.gz	Conformational Change of Tetratricopeptide Repeats Region Triggers Activation of Phytochrome-Associated Protein Phosphatase 5.
15	PDB:1wao1	0.858	0.595	1.136E-32	471	0.344	0.236	1wao1.pdb.gz	Molecular Basis for Tpr Domain-Mediated Regulation of Protein Phosphatase 5
16	PDB:4or9A	0.854	0.695	1.111E-31	399	0.341	0.276	4or9A.pdb.gz	Cooperative autoinhibition and multi-level activation mechanisms of calcineurin
17	PDB:4il1A	0.836	0.517	1.691E-31	529	0.337	0.206	4il1A.pdb.gz	Structural basis of calcineurin activation by calmodulin.
18	PDB:1g5bB	0.447	0.625	2.797E-8	221	0.139	0.204	1g5bB.pdb.gz	Structure of the bacteriophage lambda Ser/Thr protein phosphatase with sulfate ion bound in two coordination modes.
19	PDB:5vjvA	0.422	0.453	7.699E-5	298	0.139	0.151	5vjvA.pdb.gz	Structural basis for the preference of the Arabidopsis thalianaphosphatase RLPH2 for tyrosine-phosphorylated substrates.
20	PDB:5k8kA	0.334	0.431	1.321E-4	237	0.127	0.173	5k8kA.pdb.gz	Structure of the essential Haemophilus influenzae UDP-diacylglucosamine pyrophosphohydrolase LpxH in lipid A biosynthesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A140VJS9	607	341	0.932	0.883	A0A140VJS9_HUMAN Serine/threonine-protein phosphatase OS=Homo sapiens OX=9606 PE=2 SV=1
2	E9PMD7	523	295	0.824	0.902	E9PMD7_HUMAN Serine/threonine-protein phosphatase OS=Homo sapiens OX=9606 GN=PPP1CA PE=1 SV=2
3	P12982	588	302	0.864	0.924	PP12_DROME Serine/threonine-protein phosphatase alpha-2 isoform OS=Drosophila melanogaster OX=7227 GN=Pp1-87B PE=1 SV=1
4	P13681	563	327	0.827	0.817	PP11_SCHPO Serine/threonine-protein phosphatase PP1-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dis2 PE=1 SV=1
5	P20654	572	323	0.842	0.842	PP1_EMENI Serine/threonine-protein phosphatase PP1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bimG PE=2 SV=1
6	P23880	527	322	0.743	0.745	PP12_SCHPO Serine/threonine-protein phosphatase PP1-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sds21 PE=3 SV=1
7	P30366	506	318	0.728	0.739	PP11_ARATH Serine/threonine-protein phosphatase PP1 isozyme 1 OS=Arabidopsis thaliana OX=3702 GN=TOPP1 PE=1 SV=1
8	P32598	554	312	0.802	0.830	PP12_YEAST Serine/threonine-protein phosphatase PP1-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GLC7 PE=1 SV=1
9	P36873	670	323	1.000	1.000	PP1G_HUMAN Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Homo sapiens OX=9606 GN=PPP1CC PE=1 SV=1
10	P36874	667	323	0.994	0.994	PP1GA_XENLA Serine/threonine-protein phosphatase PP1-gamma catalytic subunit A OS=Xenopus laevis OX=8355 GN=ppp1cc-a PE=1 SV=2
11	P48461	601	327	0.895	0.884	PP11_DROME Serine/threonine-protein phosphatase alpha-1 isoform OS=Drosophila melanogaster OX=7227 GN=Pp1alpha-96A PE=1 SV=1
12	P48462	573	330	0.845	0.827	PP1B_DROME Serine/threonine-protein phosphatase beta isoform OS=Drosophila melanogaster OX=7227 GN=flw PE=1 SV=1
13	P48482	507	312	0.740	0.766	PP12_ARATH Serine/threonine-protein phosphatase PP1 isozyme 2 OS=Arabidopsis thaliana OX=3702 GN=TOPP2 PE=1 SV=1
14	P48484	508	321	0.731	0.735	PP14_ARATH Serine/threonine-protein phosphatase PP1 isozyme 4 OS=Arabidopsis thaliana OX=3702 GN=TOPP4 PE=1 SV=1
15	P48727	612	333	0.910	0.883	GLC7B_CAEEL Serine/threonine-protein phosphatase PP1-beta OS=Caenorhabditis elegans OX=6239 GN=gsp-2 PE=1 SV=1
16	P62136	615	330	0.932	0.912	PP1A_HUMAN Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Homo sapiens OX=9606 GN=PPP1CA PE=1 SV=1
17	P62137	615	330	0.929	0.909	PP1A_MOUSE Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Mus musculus OX=10090 GN=Ppp1ca PE=1 SV=1
18	P62138	615	330	0.932	0.912	PP1A_RAT Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Rattus norvegicus OX=10116 GN=Ppp1ca PE=1 SV=1
19	P62139	615	330	0.932	0.912	PP1A_RABIT Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Oryctolagus cuniculus OX=9986 GN=PPP1CA PE=1 SV=1
20	P62140	590	327	0.882	0.872	PP1B_HUMAN Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Homo sapiens OX=9606 GN=PPP1CB PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00149 Metallophos	1.5e-37	141.6	Calcineurin-like phosphoesterase
2	PF16891 STPPase_N	1.3e-19	81.6	Serine-threonine protein phosphatase N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9483.ENSCJAP00000016803

Rank	PPI partner	STRING score	Description
1	9483.ENSCJAP00000035868	0.975	Protein phosphatase 1, regulatory subunit 12A
2	9483.ENSCJAP00000031318	0.960	Protein phosphatase 1, regulatory subunit 3A
3	9483.ENSCJAP00000011057	0.957	Protein phosphatase 1, regulatory subunit 12B
4	9483.ENSCJAP00000016495	0.952	Protein phosphatase 1, catalytic subunit, beta isozyme
5	9483.ENSCJAP00000052181	0.952	Protein-serine/threonine phosphatase
6	9483.ENSCJAP00000009548	0.948	Protein phosphatase 1 regulatory subunit 1B
7	9483.ENSCJAP00000000399	0.945	Glycogen [starch] synthase
8	9483.ENSCJAP00000020159	0.943	Protein phosphatase 1, regulatory subunit 3C
9	9483.ENSCJAP00000040083	0.942	Protein phosphatase 1, regulatory subunit 12C
10	9483.ENSCJAP00000041339	0.942	Protein phosphatase 1, regulatory subunit 3B
11	9483.ENSCJAP00000000470	0.940	Protein phosphatase 1, regulatory subunit 15A
12	9483.ENSCJAP00000020226	0.937	SSU72 RNA polymerase II CTD phosphatase homolog (S. cerevisiae)
13	9483.ENSCJAP00000011300	0.936	WD repeat domain 82
14	9483.ENSCJAP00000015840	0.936	Uncharacterized protein
15	9483.ENSCJAP00000031226	0.936	Protein phosphatase 1, regulatory subunit 15B
16	9483.ENSCJAP00000015070	0.935	Uncharacterized protein
17	9483.ENSCJAP00000011625	0.932	Protein phosphatase 1, regulatory subunit 7
18	9483.ENSCJAP00000016760	0.932	RB transcriptional corepressor 1
19	9483.ENSCJAP00000019774	0.925	Pre-mRNA 3' end processing protein WDR33 isoform 1
20	9483.ENSCJAP00000012718	0.921	Protein phosphatase 1, regulatory subunit 9B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004722	1.000	protein serine/threonine phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0044237	0.976	cellular metabolic process
GO:0071704	0.975	organic substance metabolic process
GO:0050789	0.975	regulation of biological process
GO:0044238	0.962	primary metabolic process
GO:0043170	0.959	macromolecule metabolic process
GO:0006807	0.939	nitrogen compound metabolic process
GO:0050794	0.934	regulation of cellular process
GO:0016311	0.921	dephosphorylation
GO:1901564	0.915	organonitrogen compound metabolic process
GO:0043412	0.797	macromolecule modification
GO:0019538	0.700	protein metabolic process
GO:0032501	0.690	multicellular organismal process
GO:0036211	0.681	protein modification process
GO:0050896	0.660	response to stimulus
GO:0032502	0.653	developmental process
GO:0006470	0.619	protein dephosphorylation
GO:0048856	0.598	anatomical structure development
GO:0007275	0.443	multicellular organism development
GO:0048518	0.429	positive regulation of biological process
GO:0019222	0.425	regulation of metabolic process
GO:0051716	0.424	cellular response to stimulus
GO:0007154	0.402	cell communication
GO:0023052	0.398	signaling
GO:0060255	0.363	regulation of macromolecule metabolic process
GO:0007165	0.363	signal transduction
GO:0048522	0.355	positive regulation of cellular process
GO:0048731	0.333	system development
GO:0048519	0.324	negative regulation of biological process
GO:0080090	0.314	regulation of primary metabolic process
GO:0031323	0.304	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	0.998	intracellular organelle
GO:0016020	0.985	membrane
GO:0043227	0.965	membrane-bounded organelle
GO:0005634	0.961	nucleus
GO:0032991	0.958	protein-containing complex
GO:0043228	0.954	non-membrane-bounded organelle
GO:0005829	0.923	cytosol
GO:0031974	0.908	membrane-enclosed lumen
GO:0070013	0.890	intracellular organelle lumen
GO:0071944	0.864	cell periphery
GO:0043232	0.827	intracellular non-membrane-bounded organelle
GO:0005886	0.810	plasma membrane
GO:0031981	0.579	nuclear lumen
GO:0005654	0.574	nucleoplasm
GO:1902494	0.429	catalytic complex
GO:0008287	0.362	protein serine/threonine phosphatase complex
GO:0030054	0.334	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.16	1.000	protein-serine/threonine phosphatase.

[back to server]