StarFunc result for job id P36888

User Input

>input (993 residues)
MPALARDGGQLPLLVVFSAMIFGTITNQDLPVIKCVLINHKNNDSSVGKSSSYPMVSESP
EDLGCALRPQSSGTVYEAAAVEVDVSASITLQVLVDAPGNISCLWVFKHSSLNCQPHFDL
QNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQD
ALVCISESVPEPIVEWVLCDSQGESCKEESPAVVKKEEKVLHELFGTDIRCCARNELGRE
CTRLFTIDLNQTPQTTLPQLFLKVGEPLWIRCKAVHVNHGFGLTWELENKALEEGNYFEM
STYSTNRTMIRILFAFVSSVARNDTGYYTCSSSKHPSQSALVTIVEKGFINATNSSEDYE
IDQYEEFCFSVRFKAYPQIRCTWTFSRKSFPCEQKGLDNGYSISKFCNHKHQPGEYIFHA
ENDDAQFTKMFTLNIRRKPQVLAEASASQASCFSDGYPLPSWTWKKCSDKSPNCTEEITE
GVWNRKANRKVFGQWVSSSTLNMSEAIKGFLVKCCAYNSLGTSCETILLNSPGPFPFIQD
NISFYATIGVCLLFIVVLTLLICHKYKKQFRYESQLQMVQVTGSSDNEYFYVDFREYEYD
LKWEFPRENLEFGKVLGSGAFGKVMNATAYGISKTGVSIQVAVKMLKEKADSSEREALMS
ELKMMTQLGSHENIVNLLGACTLSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFKE
HNFSFYPTFQSHPNSSMPGSREVQIHPDSDQISGLHGNSFHSEDEIEYENQKRLEEEEDL
NVLTFEDLLCFAYQVAKGMEFLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARDIMSDS
NYVVRGNARLPVKWMAPESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDANFYK
LIQNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPNLTSFLGCQLADAEEAMYQNVDG
RVSECPHTYQNRRPFSREMDLGLLSPQAQVEDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2JW59	0.664	0.659	0.000	1002	0.841	0.833	A0A0G2JW59.pdb.gz	A0A0G2JW59_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Flt3 PE=3 SV=2
2	AFDB:P36888	1.000	1.000	0.000	993	1.000	1.000	P36888.pdb.gz	FLT3_HUMAN Receptor-type tyrosine-protein kinase FLT3 OS=Homo sapiens OX=9606 GN=FLT3 PE=1 SV=2
3	AFDB:E7F1P1	0.362	0.376	1.133E-83	956	0.346	0.360	E7F1P1.pdb.gz	E7F1P1_DANRE receptor protein-tyrosine kinase OS=Danio rerio OX=7955 GN=flt3 PE=3 SV=1
4	AFDB:Q8JFR5	0.350	0.356	4.507E-75	976	0.318	0.324	Q8JFR5.pdb.gz	KITA_DANRE Mast/stem cell growth factor receptor kita OS=Danio rerio OX=7955 GN=kita PE=2 SV=2
5	AFDB:B8A5K6	0.338	0.350	1.067E-73	957	0.308	0.320	B8A5K6.pdb.gz	B8A5K6_DANRE Mast/stem cell growth factor receptor OS=Danio rerio OX=7955 GN=kitb PE=3 SV=1
6	AFDB:P05532	0.339	0.343	5.189E-73	979	0.308	0.313	P05532.pdb.gz	KIT_MOUSE Mast/stem cell growth factor receptor Kit OS=Mus musculus OX=10090 GN=Kit PE=1 SV=3
7	AFDB:P10721	0.350	0.356	7.806E-73	976	0.318	0.324	P10721.pdb.gz	KIT_HUMAN Mast/stem cell growth factor receptor Kit OS=Homo sapiens OX=9606 GN=KIT PE=1 SV=1
8	AFDB:Q9I8N6	0.334	0.339	1.847E-71	977	0.308	0.313	Q9I8N6.pdb.gz	CSF1R_DANRE Macrophage colony-stimulating factor 1 receptor OS=Danio rerio OX=7955 GN=csf1r PE=2 SV=1
9	AFDB:P16234	0.328	0.299	8.540E-71	1089	0.311	0.284	P16234.pdb.gz	PGFRA_HUMAN Platelet-derived growth factor receptor alpha OS=Homo sapiens OX=9606 GN=PDGFRA PE=1 SV=1
10	AFDB:P05622	0.350	0.318	6.250E-70	1098	0.281	0.254	P05622.pdb.gz	PGFRB_MOUSE Platelet-derived growth factor receptor beta OS=Mus musculus OX=10090 GN=Pdgfrb PE=1 SV=2
11	PDB:1k9aB	0.239	0.527	1.270E-19	441	0.109	0.245	1k9aB.pdb.gz
12	PDB:2h8hA	0.239	0.509	7.203E-19	445	0.116	0.258	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
13	PDB:4fl2A	0.247	0.430	6.803E-18	555	0.098	0.175	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:4k2rA	0.244	0.430	2.989E-17	551	0.092	0.165	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:6s73A	0.232	0.789	1.854E-14	269	0.069	0.257	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
16	PDB:1e07A	0.105	0.137	2.935E-14	642	0.068	0.106	1e07A.pdb.gz
17	PDB:6dldD	0.144	0.440	3.788E-14	269	0.056	0.208	6dldD.pdb.gz
18	PDB:2rcjC	0.126	0.225	4.618E-13	523	0.058	0.111	2rcjC.pdb.gz
19	PDB:5oj2B	0.132	0.173	2.246E-12	692	0.080	0.114	5oj2B.pdb.gz
20	PDB:4rewA	0.223	0.503	3.938E-12	411	0.077	0.185	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JW59	0.0	1752	1000	0.844	0.838	A0A0G2JW59_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Flt3 PE=3 SV=2
2	E7F1P1	0.0	577	956	0.346	0.360	E7F1P1_DANRE receptor protein-tyrosine kinase OS=Danio rerio OX=7955 GN=flt3 PE=3 SV=1
3	P36888	0.0	2078	993	1.000	1.000	FLT3_HUMAN Receptor-type tyrosine-protein kinase FLT3 OS=Homo sapiens OX=9606 GN=FLT3 PE=1 SV=2
4	Q00342	0.0	1756	1000	0.849	0.843	FLT3_MOUSE Receptor-type tyrosine-protein kinase FLT3 OS=Mus musculus OX=10090 GN=Flt3 PE=1 SV=2
5	Q8JFR5	4.30e-153	480	976	0.295	0.300	KITA_DANRE Mast/stem cell growth factor receptor kita OS=Danio rerio OX=7955 GN=kita PE=2 SV=2
6	B8A5K6	4.25e-149	469	957	0.286	0.297	B8A5K6_DANRE Mast/stem cell growth factor receptor OS=Danio rerio OX=7955 GN=kitb PE=3 SV=1
7	Q9I8N6	1.79e-143	455	977	0.287	0.292	CSF1R_DANRE Macrophage colony-stimulating factor 1 receptor OS=Danio rerio OX=7955 GN=csf1r PE=2 SV=1
8	Q63116	2.40e-143	454	978	0.313	0.318	Q63116_RAT Mast/stem cell growth factor receptor OS=Rattus norvegicus OX=10116 GN=Kit PE=1 SV=1
9	A0A0G2JTL4	2.43e-143	454	970	0.313	0.321	A0A0G2JTL4_RAT Mast/stem cell growth factor receptor OS=Rattus norvegicus OX=10116 GN=Kit PE=1 SV=2
10	P05532	2.01e-142	452	979	0.310	0.315	KIT_MOUSE Mast/stem cell growth factor receptor Kit OS=Mus musculus OX=10090 GN=Kit PE=1 SV=3
11	P07333	4.97e-140	446	972	0.282	0.288	CSF1R_HUMAN Macrophage colony-stimulating factor 1 receptor OS=Homo sapiens OX=9606 GN=CSF1R PE=1 SV=2
12	P09581	2.80e-138	441	977	0.284	0.289	CSF1R_MOUSE Macrophage colony-stimulating factor 1 receptor OS=Mus musculus OX=10090 GN=Csf1r PE=1 SV=3
13	P10721	5.12e-138	440	976	0.305	0.310	KIT_HUMAN Mast/stem cell growth factor receptor Kit OS=Homo sapiens OX=9606 GN=KIT PE=1 SV=1
14	Q00495	6.78e-137	437	978	0.283	0.287	CSF1R_RAT Macrophage colony-stimulating factor 1 receptor OS=Rattus norvegicus OX=10116 GN=Csf1r PE=1 SV=1
15	P20786	1.33e-132	429	1088	0.277	0.253	PGFRA_RAT Platelet-derived growth factor receptor alpha OS=Rattus norvegicus OX=10116 GN=Pdgfra PE=1 SV=2
16	P26618	3.32e-131	425	1089	0.281	0.256	PGFRA_MOUSE Platelet-derived growth factor receptor alpha OS=Mus musculus OX=10090 GN=Pdgfra PE=1 SV=3
17	P16234	4.81e-130	422	1089	0.274	0.250	PGFRA_HUMAN Platelet-derived growth factor receptor alpha OS=Homo sapiens OX=9606 GN=PDGFRA PE=1 SV=1
18	Q05030	4.02e-126	412	1097	0.275	0.249	PGFRB_RAT Platelet-derived growth factor receptor beta OS=Rattus norvegicus OX=10116 GN=Pdgfrb PE=2 SV=2
19	Q9PUF6	1.96e-125	410	1087	0.271	0.247	PGFRA_CHICK Platelet-derived growth factor receptor alpha OS=Gallus gallus OX=9031 GN=PDGFRA PE=2 SV=1
20	Q9DE49	2.51e-125	409	1059	0.270	0.253	PGFRA_DANRE Platelet-derived growth factor receptor alpha OS=Danio rerio OX=7955 GN=pdgfra PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	74	14.6	Phosphotransferase enzyme family
2	PF14575 EphA2_TM	6.3e+02	12.5	Ephrin type-A receptor 2 transmembrane domain
3	PF12330 Haspin_kinase	48	14.4	Haspin like kinase domain
4	PF07679 I-set	0.00016	33.0	Immunoglobulin I-set domain
5	PF00047 ig	1.2e-07	43.1	Immunoglobulin domain
6	PF13895 Ig_2	0.00075	31.1	Immunoglobulin domain
7	PF13927 Ig_3	4.7e-05	35.2	Immunoglobulin domain
8	PF00069 Pkinase	7.6e-38	142.0	Protein kinase domain
9	PF07714 PK_Tyr_Ser-Thr	1.5e-99	344.1	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000241453

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000469613	0.999	Fms-related tyrosine kinase 3 ligand
2	9606.ENSP00000376345	0.996	Growth factor receptor-bound protein 2
3	9606.ENSP00000335153	0.978	Heat shock protein HSP 90-alpha
4	9606.ENSP00000358548	0.974	GTPase NRas
5	9606.ENSP00000407586	0.974	GTPase HRas
6	9606.ENSP00000340944	0.963	Tyrosine-protein phosphatase non-receptor type 11
7	9606.ENSP00000427514	0.962	CCAAT/enhancer-binding protein alpha
8	9606.ENSP00000256078	0.961	GTPase KRas
9	9606.ENSP00000428056	0.957	Phosphatidylinositol 3-kinase regulatory subunit alpha
10	9606.ENSP00000228280	0.955	Kit ligand
11	9606.ENSP00000341208	0.948	Signal transducer and activator of transcription 5A
12	9606.ENSP00000221665	0.947	Flt3-interacting zinc finger protein 1
13	9606.ENSP00000264657	0.947	Signal transducer and activator of transcription 3
14	9606.ENSP00000227163	0.945	Transcription factor PU.1
15	9606.ENSP00000293328	0.944	Signal transducer and activator of transcription 5B
16	9606.ENSP00000441543	0.941	Polyubiquitin-C
17	9606.ENSP00000400010	0.937	Receptor-type tyrosine-protein phosphatase eta
18	9606.ENSP00000228872	0.929	Cyclin-dependent kinase inhibitor 1B
19	9606.ENSP00000272317	0.918	Ubiquitin-40S ribosomal protein S27a
20	9606.ENSP00000304697	0.915	Polyubiquitin-B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004713	1.000	protein tyrosine kinase activity
GO:0004888	0.999	transmembrane signaling receptor activity
GO:0004714	0.977	transmembrane receptor protein tyrosine kinase activity
GO:0043621	0.890	protein self-association
GO:0005102	0.316	signaling receptor binding
GO:0061629	0.312	RNA polymerase II-specific DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.988	response to stimulus
GO:0009987	0.988	cellular process
GO:0050794	0.984	regulation of cellular process
GO:0051716	0.975	cellular response to stimulus
GO:0048518	0.975	positive regulation of biological process
GO:0019222	0.969	regulation of metabolic process
GO:0007154	0.967	cell communication
GO:0023052	0.965	signaling
GO:0032501	0.956	multicellular organismal process
GO:0060255	0.949	regulation of macromolecule metabolic process
GO:0048856	0.927	anatomical structure development
GO:0048519	0.927	negative regulation of biological process
GO:0048522	0.923	positive regulation of cellular process
GO:0042127	0.919	regulation of cell population proliferation
GO:0071704	0.917	organic substance metabolic process
GO:0007166	0.910	cell surface receptor signaling pathway
GO:0042221	0.895	response to chemical
GO:0048583	0.893	regulation of response to stimulus
GO:0010604	0.892	positive regulation of macromolecule metabolic process
GO:0010033	0.884	response to organic substance
GO:0016310	0.869	phosphorylation
GO:0044238	0.868	primary metabolic process
GO:0070887	0.859	cellular response to chemical stimulus
GO:0034097	0.857	response to cytokine
GO:0030154	0.847	cell differentiation
GO:0071310	0.843	cellular response to organic substance
GO:1902533	0.825	positive regulation of intracellular signal transduction
GO:0043170	0.824	macromolecule metabolic process
GO:0006807	0.823	nitrogen compound metabolic process
GO:0071345	0.820	cellular response to cytokine stimulus
GO:0001934	0.820	positive regulation of protein phosphorylation
GO:0010468	0.802	regulation of gene expression
GO:1901564	0.779	organonitrogen compound metabolic process
GO:0043549	0.777	regulation of kinase activity
GO:0030097	0.771	hemopoiesis
GO:0044093	0.745	positive regulation of molecular function
GO:0051239	0.744	regulation of multicellular organismal process
GO:0051347	0.727	positive regulation of transferase activity
GO:0019221	0.727	cytokine-mediated signaling pathway
GO:0036211	0.696	protein modification process
GO:0006468	0.680	protein phosphorylation
GO:0050731	0.637	positive regulation of peptidyl-tyrosine phosphorylation
GO:0033674	0.627	positive regulation of kinase activity
GO:0046777	0.562	protein autophosphorylation
GO:0048523	0.504	negative regulation of cellular process
GO:0007275	0.471	multicellular organism development
GO:0042531	0.441	positive regulation of tyrosine phosphorylation of STAT protein
GO:0043408	0.435	regulation of MAPK cascade
GO:0008284	0.413	positive regulation of cell population proliferation
GO:0007167	0.412	enzyme-linked receptor protein signaling pathway
GO:0014066	0.379	regulation of phosphatidylinositol 3-kinase signaling
GO:0006950	0.376	response to stress
GO:0048731	0.370	system development
GO:0007169	0.361	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0009719	0.347	response to endogenous stimulus
GO:0043410	0.328	positive regulation of MAPK cascade
GO:0009892	0.326	negative regulation of metabolic process
GO:0045859	0.324	regulation of protein kinase activity
GO:0002376	0.315	immune system process
GO:0002682	0.315	regulation of immune system process
GO:0010605	0.314	negative regulation of macromolecule metabolic process
GO:0043067	0.312	regulation of programmed cell death
GO:0048513	0.311	animal organ development
GO:0009889	0.302	regulation of biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.997	intracellular anatomical structure
GO:0043226	0.976	organelle
GO:0043227	0.966	membrane-bounded organelle
GO:0043229	0.958	intracellular organelle
GO:0043231	0.954	intracellular membrane-bounded organelle
GO:0005737	0.946	cytoplasm
GO:0012505	0.916	endomembrane system
GO:0031982	0.564	vesicle
GO:0005634	0.399	nucleus
GO:0005829	0.323	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	1.000	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.1	0.977	receptor protein-tyrosine kinase.

[back to server]