StarFunc result for job id P36894

User Input

>input (532 residues)
MPQLYIYIRLLGAYLFIISRVQGQNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLK
CYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRR
TIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRWLVLLISMAVCIIAMIIFSSCFCYKHYC
KSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQV
GKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTG
SWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAH
RDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKN
HFQPYIMADIYSFGLIIWEMARRCITGGIVEEYQLPYYNMVPSDPSYEDMREVVCVKRLR
PIVSNRWNSDECLRAVLKLMSECWAHNPASRLTALRIKKTLAKMVESQDVKI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1P3H0	0.704	0.702	1.784E-96	533	0.914	0.912	F1P3H0.pdb.gz	F1P3H0_CHICK receptor protein serine/threonine kinase OS=Gallus gallus OX=9031 GN=BMPR1A PE=3 SV=1
2	AFDB:A0A0R4IZG7	0.645	0.642	5.074E-85	535	0.750	0.746	A0A0R4IZG7.pdb.gz
3	AFDB:O93243	0.646	0.652	1.231E-84	527	0.752	0.759	O93243.pdb.gz
4	AFDB:M0R3J4	0.617	0.653	9.677E-79	502	0.673	0.713	M0R3J4.pdb.gz	M0R3J4_RAT Serine/threonine-protein kinase receptor OS=Rattus norvegicus OX=10116 GN=Bmpr1b PE=3 SV=2
5	AFDB:A0A0R4I9Y4	0.617	0.613	1.426E-78	535	0.667	0.664	A0A0R4I9Y4.pdb.gz
6	AFDB:F1NTD3	0.636	0.674	4.087E-78	502	0.680	0.721	F1NTD3.pdb.gz	F1NTD3_CHICK receptor protein serine/threonine kinase OS=Gallus gallus OX=9031 GN=BMPR1B PE=3 SV=1
7	AFDB:Q9W629	0.632	0.634	1.462E-77	530	0.675	0.677	Q9W629.pdb.gz	Q9W629_DANRE Serine/threonine-protein kinase receptor OS=Danio rerio OX=7955 GN=bmpr1b PE=2 SV=1
8	AFDB:Q9VMT1	0.592	0.548	8.972E-64	575	0.487	0.450	Q9VMT1.pdb.gz	Q9VMT1_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=tkv PE=2 SV=2
9	AFDB:P37172	0.623	0.651	8.914E-62	509	0.453	0.473	P37172.pdb.gz	ACVR1_MOUSE Activin receptor type-1 OS=Mus musculus OX=10090 GN=Acvr1 PE=1 SV=2
10	AFDB:P36897	0.614	0.648	1.314E-61	503	0.483	0.511	P36897.pdb.gz	TGFR1_HUMAN TGF-beta receptor type-1 OS=Homo sapiens OX=9606 GN=TGFBR1 PE=1 SV=1
11	PDB:1k9aB	0.416	0.495	8.367E-17	441	0.143	0.172	1k9aB.pdb.gz
12	PDB:8dksA	0.381	0.689	1.921E-16	283	0.139	0.261	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
13	PDB:4btfA	0.394	0.496	2.678E-16	413	0.132	0.169	4btfA.pdb.gz
14	PDB:6lk5A	0.410	0.785	7.675E-16	265	0.120	0.242	6lk5A.pdb.gz
15	PDB:2h8hA	0.406	0.479	9.579E-16	445	0.156	0.187	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
16	PDB:1unlA	0.399	0.698	2.457E-15	292	0.128	0.233	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
17	PDB:4krcA	0.405	0.699	2.597E-15	297	0.133	0.239	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
18	PDB:4yc3A	0.397	0.686	2.597E-15	295	0.139	0.251	4yc3A.pdb.gz
19	PDB:4eomC	0.386	0.712	7.441E-15	276	0.143	0.275	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
20	PDB:5ufuA	0.406	0.570	8.787E-15	369	0.124	0.179	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZJI2	739	502	0.675	0.715	A0A8I5ZJI2_RAT Serine/threonine-protein kinase receptor OS=Rattus norvegicus OX=10116 GN=Bmpr1b PE=3 SV=1
2	A0A8I5ZXN2	739	550	0.684	0.662	A0A8I5ZXN2_RAT Serine/threonine-protein kinase receptor OS=Rattus norvegicus OX=10116 GN=Bmpr1b PE=3 SV=1
3	A0A8I6A0G0	739	550	0.684	0.662	A0A8I6A0G0_RAT Serine/threonine-protein kinase receptor OS=Rattus norvegicus OX=10116 GN=Bmpr1b PE=3 SV=1
4	B3DJG0	831	526	0.761	0.770	B3DJG0_DANRE receptor protein serine/threonine kinase OS=Danio rerio OX=7955 GN=bmpr1a PE=2 SV=1
5	C0L3D6	729	535	0.684	0.680	C0L3D6_DANRE Serine/threonine-protein kinase receptor OS=Danio rerio OX=7955 GN=alk6b PE=2 SV=1
6	F1NTD3	740	502	0.680	0.721	F1NTD3_CHICK receptor protein serine/threonine kinase OS=Gallus gallus OX=9031 GN=BMPR1B PE=3 SV=1
7	F1P3H0	997	533	0.914	0.912	F1P3H0_CHICK receptor protein serine/threonine kinase OS=Gallus gallus OX=9031 GN=BMPR1A PE=3 SV=1
8	M0R3J4	705	491	0.647	0.701	M0R3J4_RAT Serine/threonine-protein kinase receptor OS=Rattus norvegicus OX=10116 GN=Bmpr1b PE=3 SV=2
9	O00238	741	502	0.677	0.717	BMR1B_HUMAN Bone morphogenetic protein receptor type-1B OS=Homo sapiens OX=9606 GN=BMPR1B PE=1 SV=1
10	P36894	1113	532	1.000	1.000	BMR1A_HUMAN Bone morphogenetic protein receptor type-1A OS=Homo sapiens OX=9606 GN=BMPR1A PE=1 SV=2
11	P36895	1091	532	0.979	0.979	BMR1A_MOUSE Bone morphogenetic protein receptor type-1A OS=Mus musculus OX=10090 GN=Bmpr1a PE=1 SV=1
12	P36898	737	502	0.675	0.715	BMR1B_MOUSE Bone morphogenetic protein receptor type-1B OS=Mus musculus OX=10090 GN=Bmpr1b PE=1 SV=1
13	Q05438	735	502	0.679	0.719	BMR1B_CHICK Bone morphogenetic protein receptor type-1B OS=Gallus gallus OX=9031 GN=BMPR1B PE=1 SV=1
14	Q1RLX1	829	527	0.761	0.769	Q1RLX1_DANRE receptor protein serine/threonine kinase OS=Danio rerio OX=7955 GN=zgc:136731 PE=2 SV=1
15	Q569A5	552	297	0.472	0.845	Q569A5_RAT receptor protein serine/threonine kinase OS=Rattus norvegicus OX=10116 GN=Bmpr1b PE=2 SV=1
16	Q66HY1	800	534	0.739	0.736	Q66HY1_DANRE receptor protein serine/threonine kinase OS=Danio rerio OX=7955 GN=zgc:92227 PE=2 SV=1
17	Q78EA7	1086	532	0.970	0.970	BMR1A_RAT Bone morphogenetic protein receptor type-1A OS=Rattus norvegicus OX=10116 GN=Bmpr1a PE=2 SV=1
18	Q90754	995	533	0.912	0.910	Q90754_CHICK receptor protein serine/threonine kinase OS=Gallus gallus OX=9031 GN=BRK-1 PE=2 SV=1
19	Q95L23	743	502	0.677	0.717	Q95L23_PIG receptor protein serine/threonine kinase OS=Sus scrofa OX=9823 GN=BMPR1B PE=2 SV=1
20	Q9W629	719	530	0.673	0.675	Q9W629_DANRE Serine/threonine-protein kinase receptor OS=Danio rerio OX=7955 GN=bmpr1b PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	4.4e+02	11.3	ABC1 atypical kinase-like domain
2	PF01064 Activin_recp	6.7e-08	44.7	Activin types I and II receptor domain
3	PF01636 APH	7.7e+02	11.3	Phosphotransferase enzyme family
4	PF13095 FTA2	41	15.3	Kinetochore Sim4 complex subunit FTA2
5	PF12330 Haspin_kinase	3.1e+02	11.7	Haspin like kinase domain
6	PF00069 Pkinase	7.8e-34	128.8	Protein kinase domain
7	PF17667 Pkinase_fungal	0.082	23.3	Fungal protein kinase
8	PF07714 PK_Tyr_Ser-Thr	3.2e-34	130.0	Protein tyrosine and serine/threonine kinase
9	PF08515 TGF_beta_GS	1.4e-12	58.2	Transforming growth factor beta type I GS-motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361107

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000245451	0.999	Bone morphogenetic protein 4
2	9606.ENSP00000368104	0.999	Bone morphogenetic protein 2
3	9606.ENSP00000379204	0.999	Bone morphogenetic protein 7
4	9606.ENSP00000283147	0.998	Bone morphogenetic protein 6
5	9606.ENSP00000363492	0.997	Growth/differentiation factor 5
6	9606.ENSP00000426568	0.992	Mothers against decapentaplegic homolog 1
7	9606.ENSP00000262158	0.987	Mothers against decapentaplegic homolog 7
8	9606.ENSP00000288840	0.986	Mothers against decapentaplegic homolog 6
9	9606.ENSP00000337014	0.986	Hemojuvelin
10	9606.ENSP00000328181	0.984	Noggin
11	9606.ENSP00000241416	0.983	Activin receptor type-2A
12	9606.ENSP00000359866	0.982	Bone morphogenetic protein 5
13	9606.ENSP00000441954	0.982	Mothers against decapentaplegic homolog 5
14	9606.ENSP00000256759	0.980	Follistatin
15	9606.ENSP00000340361	0.979	Activin receptor type-2B
16	9606.ENSP00000369154	0.976	Mothers against decapentaplegic homolog 9
17	9606.ENSP00000204604	0.975	Chordin
18	9606.ENSP00000341551	0.968	Mothers against decapentaplegic homolog 4
19	9606.ENSP00000364683	0.965	BMP and activin membrane-bound inhibitor homolog
20	9606.ENSP00000478319	0.965	Gremlin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0004674	0.997	protein serine/threonine kinase activity
GO:0060089	0.932	molecular transducer activity
GO:0097159	0.893	organic cyclic compound binding
GO:1901363	0.890	heterocyclic compound binding
GO:0019199	0.829	transmembrane receptor protein kinase activity
GO:0004675	0.812	transmembrane receptor protein serine/threonine kinase activity
GO:0043167	0.642	ion binding
GO:0019955	0.588	cytokine binding
GO:0044877	0.568	protein-containing complex binding
GO:0046332	0.535	SMAD binding
GO:0097367	0.489	carbohydrate derivative binding
GO:0019838	0.444	growth factor binding
GO:0043168	0.402	anion binding
GO:0032559	0.352	adenyl ribonucleotide binding
GO:0005102	0.323	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007178	0.989	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0048522	0.988	positive regulation of cellular process
GO:0071773	0.986	cellular response to BMP stimulus
GO:0051239	0.985	regulation of multicellular organismal process
GO:0050793	0.985	regulation of developmental process
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0072359	0.985	circulatory system development
GO:0080090	0.984	regulation of primary metabolic process
GO:0051171	0.984	regulation of nitrogen compound metabolic process
GO:0045595	0.984	regulation of cell differentiation
GO:0031323	0.984	regulation of cellular metabolic process
GO:0048519	0.983	negative regulation of biological process
GO:0030509	0.982	BMP signaling pathway
GO:0010468	0.980	regulation of gene expression
GO:0009889	0.976	regulation of biosynthetic process
GO:0009893	0.976	positive regulation of metabolic process
GO:0019219	0.972	regulation of nucleobase-containing compound metabolic process
GO:0071560	0.971	cellular response to transforming growth factor beta stimulus
GO:0010604	0.971	positive regulation of macromolecule metabolic process
GO:0048513	0.970	animal organ development
GO:0051173	0.966	positive regulation of nitrogen compound metabolic process
GO:0048523	0.965	negative regulation of cellular process
GO:0031325	0.964	positive regulation of cellular metabolic process
GO:0048583	0.961	regulation of response to stimulus
GO:0061311	0.961	cell surface receptor signaling pathway involved in heart development
GO:0045667	0.960	regulation of osteoblast differentiation
GO:0006355	0.955	regulation of DNA-templated transcription
GO:0009653	0.947	anatomical structure morphogenesis
GO:0045597	0.944	positive regulation of cell differentiation
GO:0010646	0.943	regulation of cell communication
GO:0070167	0.943	regulation of biomineral tissue development
GO:0023051	0.941	regulation of signaling
GO:0030278	0.941	regulation of ossification
GO:0008284	0.937	positive regulation of cell population proliferation
GO:0060393	0.929	regulation of pathway-restricted SMAD protein phosphorylation
GO:0030501	0.925	positive regulation of bone mineralization
GO:0045669	0.924	positive regulation of osteoblast differentiation
GO:0009966	0.914	regulation of signal transduction
GO:0071704	0.900	organic substance metabolic process
GO:0031328	0.891	positive regulation of cellular biosynthetic process
GO:0030154	0.887	cell differentiation
GO:0044237	0.885	cellular metabolic process
GO:0090092	0.885	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0043170	0.882	macromolecule metabolic process
GO:0006807	0.881	nitrogen compound metabolic process
GO:0007179	0.877	transforming growth factor beta receptor signaling pathway
GO:0051247	0.865	positive regulation of protein metabolic process
GO:0044238	0.843	primary metabolic process
GO:0016310	0.836	phosphorylation
GO:0010557	0.835	positive regulation of macromolecule biosynthetic process
GO:0045935	0.835	positive regulation of nucleobase-containing compound metabolic process
GO:1903508	0.829	positive regulation of nucleic acid-templated transcription
GO:0048660	0.819	regulation of smooth muscle cell proliferation
GO:0045893	0.813	positive regulation of DNA-templated transcription
GO:0040008	0.788	regulation of growth
GO:0006468	0.783	protein phosphorylation
GO:1904705	0.757	regulation of vascular associated smooth muscle cell proliferation
GO:0035107	0.755	appendage morphogenesis
GO:0006357	0.750	regulation of transcription by RNA polymerase II
GO:0045944	0.732	positive regulation of transcription by RNA polymerase II
GO:0048584	0.730	positive regulation of response to stimulus
GO:0048661	0.730	positive regulation of smooth muscle cell proliferation
GO:0009967	0.724	positive regulation of signal transduction
GO:1904707	0.689	positive regulation of vascular associated smooth muscle cell proliferation
GO:0009888	0.663	tissue development
GO:0001944	0.662	vasculature development
GO:0009887	0.646	animal organ morphogenesis
GO:0007389	0.584	pattern specification process
GO:0044260	0.556	cellular macromolecule metabolic process
GO:0048646	0.503	anatomical structure formation involved in morphogenesis
GO:0003002	0.501	regionalization
GO:0031401	0.476	positive regulation of protein modification process
GO:0009892	0.461	negative regulation of metabolic process
GO:0048729	0.436	tissue morphogenesis
GO:0048468	0.428	cell development
GO:0009790	0.421	embryo development
GO:0010605	0.420	negative regulation of macromolecule metabolic process
GO:0031324	0.327	negative regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0032991	0.931	protein-containing complex
GO:0043231	0.783	intracellular membrane-bounded organelle
GO:0005737	0.639	cytoplasm
GO:0070013	0.394	intracellular organelle lumen
GO:0009986	0.364	cell surface

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.997	Phosphotransferases with an alcohol group as acceptor.
RHEA:18673	0.812	ATP + L-seryl-[receptor-protein] = ADP + H(+) + O-phospho-L-seryl-[receptor-protein]
EC:2.7.11.30	0.812	receptor protein serine/threonine kinase.

[back to server]