StarFunc result for job id P36896

User Input

>input (505 residues)
MAESAGASSFFPLVVLLLAGSGGSGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLD
GMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPS
MWGPVELVGIIAGPVFLLFLIIIIVFLVINYHQRVYHNRQRLDMEDPSCEMCLSKDKTLQ
DLVYDLSTSGSGSGLPLFVQRTVARTIVLQEIIGKGRFGEVWRGRWRGGDVAVKIFSSRE
ERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVT
IEGMIKLALSAASGLAHLHMEIVGTQGKPGIAHRDLKSKNILVKKNGMCAIADLGLAVRH
DAVTDTIDIAPNQRVGTKRYMAPEVLDETINMKHFDSFKCADIYALGLVYWEIARRCNSG
GVHEEYQLPYYDLVPSDPSIEEMRKVVCDQKLRPNIPNWWQSYEALRVMGKMMRECWYAN
GAARLTALRIKKTLSQLSVQEDVKI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P36896	1.000	1.000	1.009E-100	505	1.000	1.000	P36896.pdb.gz	ACV1B_HUMAN Activin receptor type-1B OS=Homo sapiens OX=9606 GN=ACVR1B PE=1 SV=1
2	AFDB:B3DJ37	0.681	0.681	1.741E-86	505	0.790	0.790	B3DJ37.pdb.gz
3	AFDB:P36897	0.671	0.673	8.391E-78	503	0.691	0.694	P36897.pdb.gz	TGFR1_HUMAN TGF-beta receptor type-1 OS=Homo sapiens OX=9606 GN=TGFBR1 PE=1 SV=1
4	AFDB:P70539	0.658	0.674	1.578E-74	493	0.622	0.637	P70539.pdb.gz	ACV1C_RAT Activin receptor type-1C OS=Rattus norvegicus OX=10116 GN=Acvr1c PE=1 SV=1
5	AFDB:A1Z7L9	0.674	0.568	3.019E-68	601	0.537	0.451	A1Z7L9.pdb.gz	A1Z7L9_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=babo PE=3 SV=1
6	AFDB:A1Z7L8	0.667	0.544	8.611E-67	622	0.535	0.434	A1Z7L8.pdb.gz	A1Z7L8_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=babo PE=3 SV=1
7	AFDB:F1NTD3	0.676	0.680	4.679E-63	502	0.499	0.502	F1NTD3.pdb.gz	F1NTD3_CHICK receptor protein serine/threonine kinase OS=Gallus gallus OX=9031 GN=BMPR1B PE=3 SV=1
8	AFDB:M0R3J4	0.686	0.690	3.125E-62	502	0.497	0.500	M0R3J4.pdb.gz	M0R3J4_RAT Serine/threonine-protein kinase receptor OS=Rattus norvegicus OX=10116 GN=Bmpr1b PE=3 SV=2
9	AFDB:A0A0R4IZG7	0.654	0.618	3.907E-62	535	0.489	0.462	A0A0R4IZG7.pdb.gz
10	AFDB:Q90ZK6	0.644	0.645	9.548E-62	504	0.489	0.490	Q90ZK6.pdb.gz	ACVR1_CHICK Activin receptor type-1 OS=Gallus gallus OX=9031 GN=ACVR1 PE=2 SV=1
11	PDB:8dksA	0.405	0.695	1.734E-16	283	0.141	0.251	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
12	PDB:1k9aB	0.435	0.496	1.834E-16	441	0.147	0.168	1k9aB.pdb.gz
13	PDB:1unlA	0.422	0.701	7.407E-16	292	0.123	0.212	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
14	PDB:2h8hA	0.430	0.483	7.407E-16	445	0.152	0.173	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
15	PDB:4krcA	0.426	0.699	1.448E-15	297	0.147	0.249	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
16	PDB:5u6yA	0.416	0.455	2.263E-15	459	0.127	0.139	5u6yA.pdb.gz
17	PDB:4zhxA	0.434	0.528	2.676E-15	409	0.131	0.161	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
18	PDB:2bujA	0.436	0.737	3.956E-15	291	0.129	0.223	2bujA.pdb.gz	Crystal Structure of the Human Serine-Threonine Kinase 16 in Complex with Staurosporine
19	PDB:2qkwB	0.423	0.705	3.956E-15	292	0.145	0.250	2qkwB.pdb.gz
20	PDB:4c0tA	0.431	0.714	4.947E-15	291	0.101	0.175	4c0tA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1Z7L8	0.0	527	622	0.554	0.450	A1Z7L8_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=babo PE=3 SV=1
2	A1Z7L9	0.0	541	601	0.549	0.461	A1Z7L9_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=babo PE=3 SV=1
3	B4DY26	0.0	671	434	0.650	0.756	B4DY26_HUMAN receptor protein serine/threonine kinase OS=Homo sapiens OX=9606 GN=TGFBR1 PE=1 SV=1
4	O46680	0.0	695	499	0.677	0.685	TGFR1_BOVIN TGF-beta receptor type-1 OS=Bos taurus OX=9913 GN=TGFBR1 PE=2 SV=1
5	P36896	0.0	1055	505	1.000	1.000	ACV1B_HUMAN Activin receptor type-1B OS=Homo sapiens OX=9606 GN=ACVR1B PE=1 SV=1
6	P36897	0.0	696	503	0.675	0.678	TGFR1_HUMAN TGF-beta receptor type-1 OS=Homo sapiens OX=9606 GN=TGFBR1 PE=1 SV=1
7	P70539	0.0	648	493	0.622	0.637	ACV1C_RAT Activin receptor type-1C OS=Rattus norvegicus OX=10116 GN=Acvr1c PE=1 SV=1
8	P79689	0.0	820	505	0.774	0.774	P79689_DANRE receptor protein serine/threonine kinase OS=Danio rerio OX=7955 GN=axis PE=2 SV=1
9	P80202	0.0	1048	505	0.988	0.988	ACV1B_RAT Activin receptor type-1B OS=Rattus norvegicus OX=10116 GN=Acvr1b PE=2 SV=1
10	P80204	0.0	711	501	0.697	0.703	TGFR1_RAT TGF-beta receptor type-1 OS=Rattus norvegicus OX=10116 GN=Tgfbr1 PE=1 SV=1
11	Q06900	0.0	691	503	0.685	0.688	Q06900_CHICK receptor protein serine/threonine kinase OS=Gallus gallus OX=9031 GN=ChALK5 PE=2 SV=2
12	Q23975	0.0	537	601	0.547	0.459	Q23975_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=babo PE=2 SV=1
13	Q5T7S2	0.0	696	503	0.675	0.678	Q5T7S2_HUMAN receptor protein serine/threonine kinase OS=Homo sapiens OX=9606 GN=TGFBR1 PE=3 SV=1
14	Q61271	0.0	1041	505	0.982	0.982	ACV1B_MOUSE Activin receptor type-1B OS=Mus musculus OX=10090 GN=Acvr1b PE=1 SV=1
15	Q64729	0.0	708	503	0.683	0.686	TGFR1_MOUSE TGF-beta receptor type-1 OS=Mus musculus OX=10090 GN=Tgfbr1 PE=1 SV=1
16	Q7YU60	0.0	537	595	0.549	0.466	Q7YU60_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=babo PE=2 SV=1
17	Q8K348	0.0	653	493	0.624	0.639	ACV1C_MOUSE Activin receptor type-1C OS=Mus musculus OX=10090 GN=Acvr1c PE=2 SV=3
18	Q8NER5	0.0	655	493	0.630	0.645	ACV1C_HUMAN Activin receptor type-1C OS=Homo sapiens OX=9606 GN=ACVR1C PE=1 SV=1
19	F1NTD3	9.91e-162	470	502	0.501	0.504	F1NTD3_CHICK receptor protein serine/threonine kinase OS=Gallus gallus OX=9031 GN=BMPR1B PE=3 SV=1
20	Q05438	4.45e-161	468	502	0.503	0.506	BMR1B_CHICK Bone morphogenetic protein receptor type-1B OS=Gallus gallus OX=9031 GN=BMPR1B PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01064 Activin_recp	0.013	27.7	Activin types I and II receptor domain
2	PF01636 APH	2.6	19.4	Phosphotransferase enzyme family
3	PF13095 FTA2	1.8e+02	13.2	Kinetochore Sim4 complex subunit FTA2
4	PF00069 Pkinase	7.7e-30	115.7	Protein kinase domain
5	PF17667 Pkinase_fungal	4.9	17.4	Fungal protein kinase
6	PF07714 PK_Tyr_Ser-Thr	7.3e-29	112.4	Protein tyrosine and serine/threonine kinase
7	PF08515 TGF_beta_GS	1.3e-08	45.5	Transforming growth factor beta type I GS-motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9913.ENSBTAP00000043941

Rank	PPI partner	STRING score	Description
1	9913.ENSBTAP00000017649	0.989	Receptor-regulated SMAD (R-SMAD) that is an intracellular signal transducer and transcriptional modulator activated by TGF-beta (transforming growth factor) and activin type 1 receptor kinases. Binds the TRE element in the promoter region of many genes that are regulated by TGF-beta and, on formation of the SMAD2/SMAD4 complex, activates transcription. May act as a tumor suppressor in colorectal carcinoma. Positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator (By similarity)
2	9913.ENSBTAP00000015674	0.971	Growth/differentiation factor 8
3	9913.ENSBTAP00000003783	0.967	Inhibin beta A chain
4	9913.ENSBTAP00000009755	0.963	Growth differentiation factor 11
5	9913.ENSBTAP00000024108	0.959	Activin receptor type-2A
6	9913.ENSBTAP00000024095	0.955	Transmembrane serine/threonine kinase activin type-2 receptor forming an activin receptor complex with activin type-1 serine/threonine kinase receptors (ACVR1, ACVR1B or ACVR1c). Transduces the activin signal from the cell surface to the cytoplasm and is thus regulating many physiological and pathological processes including neuronal differentiation and neuronal survival, hair follicle development and cycling, FSH production by the pituitary gland, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. Activin is also thought to have a paracrine or autocr [...]
7	9913.ENSBTAP00000042801	0.955	Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins
8	9913.ENSBTAP00000017405	0.946	Nodal growth differentiation factor
9	9913.ENSBTAP00000003960	0.945	BMP and activin membrane-bound inhibitor homolog
10	9913.ENSBTAP00000008419	0.945	Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.
11	9913.ENSBTAP00000012476	0.923	Growth/differentiation factor 9
12	9913.ENSBTAP00000027261	0.919	Transforming growth factor beta-1 proprotein: Precursor of the Latency-associated peptide (LAP) and Transforming growth factor beta-1 (TGF-beta-1) chains, which constitute the regulatory and active subunit of TGF-beta-1, respectively. Transforming growth factor beta-1: Multifunctional protein that regulates the growth and differentiation of various cell types and is involved in various processes, such as normal development, immune function, microglia function and responses to neurodegeneration (By similarity). Activation into mature form follows different steps: following cleavage of t [...]
13	9913.ENSBTAP00000051827	0.911	Uncharacterized protein
14	9913.ENSBTAP00000055112	0.910	TGF-beta receptor type-2
15	9913.ENSBTAP00000009081	0.904	Common SMAD (co-SMAD) is the coactivator and mediator of signal transduction by TGF-beta (transforming growth factor). Component of the heterotrimeric SMAD2/SMAD3-SMAD4 complex that forms in the nucleus and is required for the TGF-mediated signaling. Promotes binding of the SMAD2/SMAD4/FAST-1 complex to DNA and provides an activation function required for SMAD1 or SMAD2 to stimulate transcription. Component of the multimeric SMAD3/SMAD4/JUN/FOS complex which forms at the AP1 promoter site
16	9913.ENSBTAP00000016728	0.899	Mothers against decapentaplegic homolog
17	9913.ENSBTAP00000015797	0.898	On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for TGF-beta. May also bind activin
18	9913.ENSBTAP00000001351	0.895	Growth/differentiation factor 10
19	9913.ENSBTAP00000027871	0.895	Uncharacterized protein
20	9913.ENSBTAP00000015925	0.893	Bos taurus transforming growth factor, beta 3 (TGFB3), mRNA

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0005515	0.993	protein binding
GO:0004675	0.993	transmembrane receptor protein serine/threonine kinase activity
GO:0019838	0.982	growth factor binding
GO:0048185	0.951	activin binding
GO:0043167	0.759	ion binding
GO:0046332	0.683	SMAD binding
GO:0035639	0.529	purine ribonucleoside triphosphate binding
GO:0005524	0.501	ATP binding
GO:0019955	0.494	cytokine binding
GO:0017002	0.332	activin receptor activity
GO:0016361	0.314	activin receptor activity, type I

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0009719	0.972	response to endogenous stimulus
GO:0009987	0.971	cellular process
GO:0071559	0.943	response to transforming growth factor beta
GO:0048522	0.923	positive regulation of cellular process
GO:0032501	0.891	multicellular organismal process
GO:0007154	0.857	cell communication
GO:0023052	0.849	signaling
GO:0051716	0.834	cellular response to stimulus
GO:0010604	0.826	positive regulation of macromolecule metabolic process
GO:0007165	0.820	signal transduction
GO:0007178	0.808	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0032502	0.790	developmental process
GO:0031323	0.745	regulation of cellular metabolic process
GO:0016310	0.742	phosphorylation
GO:0071704	0.725	organic substance metabolic process
GO:0010646	0.714	regulation of cell communication
GO:0023051	0.707	regulation of signaling
GO:0043170	0.703	macromolecule metabolic process
GO:0043412	0.694	macromolecule modification
GO:0044238	0.684	primary metabolic process
GO:0048856	0.636	anatomical structure development
GO:0006807	0.615	nitrogen compound metabolic process
GO:0080090	0.610	regulation of primary metabolic process
GO:0051171	0.603	regulation of nitrogen compound metabolic process
GO:0010468	0.602	regulation of gene expression
GO:0019538	0.599	protein metabolic process
GO:0036211	0.586	protein modification process
GO:0009967	0.585	positive regulation of signal transduction
GO:0018107	0.527	peptidyl-threonine phosphorylation
GO:0071495	0.493	cellular response to endogenous stimulus
GO:0051174	0.453	regulation of phosphorus metabolic process
GO:0071560	0.453	cellular response to transforming growth factor beta stimulus
GO:0048519	0.434	negative regulation of biological process
GO:0019220	0.433	regulation of phosphate metabolic process
GO:0009888	0.402	tissue development
GO:0048869	0.385	cellular developmental process
GO:0009889	0.339	regulation of biosynthetic process
GO:0090092	0.331	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0007275	0.330	multicellular organism development
GO:0051173	0.318	positive regulation of nitrogen compound metabolic process
GO:0030154	0.310	cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0032991	0.786	protein-containing complex
GO:0005622	0.642	intracellular anatomical structure
GO:0005737	0.356	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:18673	0.993	ATP + L-seryl-[receptor-protein] = ADP + H(+) + O-phospho-L-seryl-[receptor-protein]
EC:2.7.11.30	0.993	receptor protein serine/threonine kinase.

[back to server]