StarFunc result for job id P36897

User Input

>input (503 residues)
MEAAVAAPRPRLLLLVLAAAAAAAAALLPGATALQCFCHLCTKDNFTCVTDGLCFVSVTE
TTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPG
LGPVELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDL
IYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREER
SWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVE
GMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDS
ATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGI
HEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGA
ARLTALRIKKTLSQLSQQEGIKM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P36897	1.000	1.000	2.517E-101	503	1.000	1.000	P36897.pdb.gz	TGFR1_HUMAN TGF-beta receptor type-1 OS=Homo sapiens OX=9606 GN=TGFBR1 PE=1 SV=1
2	AFDB:B3DJ37	0.718	0.715	1.320E-78	505	0.686	0.683	B3DJ37.pdb.gz
3	AFDB:P36896	0.675	0.672	3.226E-78	505	0.696	0.693	P36896.pdb.gz	ACV1B_HUMAN Activin receptor type-1B OS=Homo sapiens OX=9606 GN=ACVR1B PE=1 SV=1
4	AFDB:P70539	0.675	0.689	6.679E-74	493	0.640	0.653	P70539.pdb.gz	ACV1C_RAT Activin receptor type-1C OS=Rattus norvegicus OX=10116 GN=Acvr1c PE=1 SV=1
5	AFDB:A1Z7L9	0.666	0.559	5.140E-67	601	0.549	0.459	A1Z7L9.pdb.gz	A1Z7L9_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=babo PE=3 SV=1
6	AFDB:A1Z7L8	0.656	0.531	1.660E-66	622	0.541	0.437	A1Z7L8.pdb.gz	A1Z7L8_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=babo PE=3 SV=1
7	AFDB:M0R3J4	0.718	0.720	9.647E-64	502	0.525	0.526	M0R3J4.pdb.gz	M0R3J4_RAT Serine/threonine-protein kinase receptor OS=Rattus norvegicus OX=10116 GN=Bmpr1b PE=3 SV=2
8	AFDB:F1NTD3	0.701	0.702	2.108E-63	502	0.535	0.536	F1NTD3.pdb.gz	F1NTD3_CHICK receptor protein serine/threonine kinase OS=Gallus gallus OX=9031 GN=BMPR1B PE=3 SV=1
9	AFDB:A0A0R4IZG7	0.687	0.646	4.119E-63	535	0.503	0.473	A0A0R4IZG7.pdb.gz
10	AFDB:F1P3H0	0.650	0.614	5.758E-63	533	0.515	0.486	F1P3H0.pdb.gz	F1P3H0_CHICK receptor protein serine/threonine kinase OS=Gallus gallus OX=9031 GN=BMPR1A PE=3 SV=1
11	PDB:1k9aB	0.436	0.494	3.935E-18	441	0.153	0.175	1k9aB.pdb.gz
12	PDB:8dksA	0.408	0.699	2.898E-16	283	0.135	0.240	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
13	PDB:2h8hA	0.410	0.460	4.283E-16	445	0.147	0.166	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
14	PDB:2bujA	0.439	0.736	5.355E-16	291	0.125	0.216	2bujA.pdb.gz	Crystal Structure of the Human Serine-Threonine Kinase 16 in Complex with Staurosporine
15	PDB:4krcA	0.435	0.716	6.331E-16	297	0.141	0.239	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
16	PDB:1unlA	0.415	0.692	1.308E-15	292	0.133	0.229	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
17	PDB:6lk5A	0.430	0.784	1.463E-15	265	0.121	0.230	6lk5A.pdb.gz
18	PDB:4rerA	0.426	0.464	1.730E-15	459	0.125	0.137	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
19	PDB:4zhxA	0.435	0.527	1.829E-15	409	0.135	0.166	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
20	PDB:5u6yA	0.441	0.480	2.287E-15	459	0.129	0.142	5u6yA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1Z7L8	0.0	553	622	0.555	0.449	A1Z7L8_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=babo PE=3 SV=1
2	A1Z7L9	0.0	567	601	0.555	0.464	A1Z7L9_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=babo PE=3 SV=1
3	B4DY26	0.0	910	434	0.863	1.000	B4DY26_HUMAN receptor protein serine/threonine kinase OS=Homo sapiens OX=9606 GN=TGFBR1 PE=1 SV=1
4	O46680	0.0	1012	499	0.964	0.972	TGFR1_BOVIN TGF-beta receptor type-1 OS=Bos taurus OX=9913 GN=TGFBR1 PE=2 SV=1
5	P36896	0.0	694	505	0.692	0.689	ACV1B_HUMAN Activin receptor type-1B OS=Homo sapiens OX=9606 GN=ACVR1B PE=1 SV=1
6	P36897	0.0	1050	503	1.000	1.000	TGFR1_HUMAN TGF-beta receptor type-1 OS=Homo sapiens OX=9606 GN=TGFBR1 PE=1 SV=1
7	P70539	0.0	659	493	0.640	0.653	ACV1C_RAT Activin receptor type-1C OS=Rattus norvegicus OX=10116 GN=Acvr1c PE=1 SV=1
8	P79689	0.0	682	505	0.662	0.659	P79689_DANRE receptor protein serine/threonine kinase OS=Danio rerio OX=7955 GN=axis PE=2 SV=1
9	P80202	0.0	692	505	0.692	0.689	ACV1B_RAT Activin receptor type-1B OS=Rattus norvegicus OX=10116 GN=Acvr1b PE=2 SV=1
10	P80204	0.0	991	501	0.960	0.964	TGFR1_RAT TGF-beta receptor type-1 OS=Rattus norvegicus OX=10116 GN=Tgfbr1 PE=1 SV=1
11	Q06900	0.0	929	503	0.881	0.881	Q06900_CHICK receptor protein serine/threonine kinase OS=Gallus gallus OX=9031 GN=ChALK5 PE=2 SV=2
12	Q23975	0.0	563	601	0.555	0.464	Q23975_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=babo PE=2 SV=1
13	Q5T7S2	0.0	1050	503	1.000	1.000	Q5T7S2_HUMAN receptor protein serine/threonine kinase OS=Homo sapiens OX=9606 GN=TGFBR1 PE=3 SV=1
14	Q61271	0.0	695	505	0.694	0.691	ACV1B_MOUSE Activin receptor type-1B OS=Mus musculus OX=10090 GN=Acvr1b PE=1 SV=1
15	Q64729	0.0	1003	503	0.964	0.964	TGFR1_MOUSE TGF-beta receptor type-1 OS=Mus musculus OX=10090 GN=Tgfbr1 PE=1 SV=1
16	Q7YU60	0.0	567	595	0.565	0.477	Q7YU60_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=babo PE=2 SV=1
17	Q8K348	0.0	659	493	0.638	0.651	ACV1C_MOUSE Activin receptor type-1C OS=Mus musculus OX=10090 GN=Acvr1c PE=2 SV=3
18	Q8NER5	0.0	664	493	0.650	0.663	ACV1C_HUMAN Activin receptor type-1C OS=Homo sapiens OX=9606 GN=ACVR1C PE=1 SV=1
19	F1NTD3	8.10e-172	495	502	0.529	0.530	F1NTD3_CHICK receptor protein serine/threonine kinase OS=Gallus gallus OX=9031 GN=BMPR1B PE=3 SV=1
20	Q05438	8.24e-171	493	502	0.527	0.528	BMR1B_CHICK Bone morphogenetic protein receptor type-1B OS=Gallus gallus OX=9031 GN=BMPR1B PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01064 Activin_recp	6.7e-08	44.7	Activin types I and II receptor domain
2	PF01636 APH	1.2e+02	14.0	Phosphotransferase enzyme family
3	PF13095 FTA2	2.1e+02	13.0	Kinetochore Sim4 complex subunit FTA2
4	PF12330 Haspin_kinase	2.4e+02	12.1	Haspin like kinase domain
5	PF00069 Pkinase	2e-32	124.2	Protein kinase domain
6	PF17667 Pkinase_fungal	0.53	20.6	Fungal protein kinase
7	PF07714 PK_Tyr_Ser-Thr	2e-31	120.8	Protein tyrosine and serine/threonine kinase
8	PF08515 TGF_beta_GS	6.1e-12	56.2	Transforming growth factor beta type I GS-motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364133

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000221930	0.999	Transforming growth factor beta-1
2	9606.ENSP00000238682	0.999	Transforming growth factor beta-3
3	9606.ENSP00000262158	0.999	Mothers against decapentaplegic homolog 7
4	9606.ENSP00000262160	0.999	Mothers against decapentaplegic homolog 2
5	9606.ENSP00000332973	0.999	Mothers against decapentaplegic homolog 3
6	9606.ENSP00000339191	0.999	Caveolin-1
7	9606.ENSP00000341551	0.999	Mothers against decapentaplegic homolog 4
8	9606.ENSP00000362299	0.999	Endoglin
9	9606.ENSP00000383003	0.999	Peptidyl-prolyl cis-trans isomerase FKBP1A
10	9606.ENSP00000351905	0.998	TGF-beta receptor type-2
11	9606.ENSP00000262435	0.997	E3 ubiquitin-protein ligase SMURF2
12	9606.ENSP00000433623	0.997	TNF receptor-associated factor 6
13	9606.ENSP00000355896	0.996	Transforming growth factor beta-2
14	9606.ENSP00000401303	0.996	SHC-transforming protein 1
15	9606.ENSP00000354621	0.995	E3 ubiquitin-protein ligase SMURF1
16	9606.ENSP00000360242	0.995	E3 ubiquitin-protein ligase XIAP
17	9606.ENSP00000288840	0.992	Mothers against decapentaplegic homolog 6
18	9606.ENSP00000347379	0.990	Occludin
19	9606.ENSP00000257868	0.989	Growth/differentiation factor 11
20	9606.ENSP00000313391	0.988	Disabled homolog 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.996	protein binding
GO:0004675	0.996	transmembrane receptor protein serine/threonine kinase activity
GO:0019838	0.994	growth factor binding
GO:0019955	0.993	cytokine binding
GO:0050431	0.981	transforming growth factor beta binding
GO:0005024	0.978	transforming growth factor beta receptor activity
GO:0046332	0.958	SMAD binding
GO:1901363	0.948	heterocyclic compound binding
GO:0097159	0.947	organic cyclic compound binding
GO:0043167	0.932	ion binding
GO:1901265	0.750	nucleoside phosphate binding
GO:0044877	0.748	protein-containing complex binding
GO:0097367	0.746	carbohydrate derivative binding
GO:0017076	0.708	purine nucleotide binding
GO:0005102	0.622	signaling receptor binding
GO:0035639	0.555	purine ribonucleoside triphosphate binding
GO:0005524	0.545	ATP binding
GO:0048185	0.498	activin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0070848	0.985	response to growth factor
GO:0071363	0.982	cellular response to growth factor stimulus
GO:0007178	0.976	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0048518	0.973	positive regulation of biological process
GO:0048856	0.971	anatomical structure development
GO:0032501	0.970	multicellular organismal process
GO:0071559	0.970	response to transforming growth factor beta
GO:0048869	0.967	cellular developmental process
GO:0071560	0.961	cellular response to transforming growth factor beta stimulus
GO:0007275	0.952	multicellular organism development
GO:0051171	0.948	regulation of nitrogen compound metabolic process
GO:0048523	0.947	negative regulation of cellular process
GO:0031323	0.945	regulation of cellular metabolic process
GO:0007179	0.936	transforming growth factor beta receptor signaling pathway
GO:0048513	0.934	animal organ development
GO:0080090	0.924	regulation of primary metabolic process
GO:0010604	0.923	positive regulation of macromolecule metabolic process
GO:0048522	0.917	positive regulation of cellular process
GO:0010646	0.913	regulation of cell communication
GO:0023051	0.911	regulation of signaling
GO:0009889	0.877	regulation of biosynthetic process
GO:0071704	0.806	organic substance metabolic process
GO:0042221	0.799	response to chemical
GO:0010468	0.793	regulation of gene expression
GO:0044237	0.788	cellular metabolic process
GO:0048583	0.775	regulation of response to stimulus
GO:0016310	0.774	phosphorylation
GO:0050793	0.762	regulation of developmental process
GO:0030154	0.759	cell differentiation
GO:0051173	0.757	positive regulation of nitrogen compound metabolic process
GO:0044238	0.730	primary metabolic process
GO:0042127	0.712	regulation of cell population proliferation
GO:0009966	0.701	regulation of signal transduction
GO:0048731	0.694	system development
GO:0006807	0.693	nitrogen compound metabolic process
GO:0031325	0.655	positive regulation of cellular metabolic process
GO:0043170	0.649	macromolecule metabolic process
GO:0051239	0.645	regulation of multicellular organismal process
GO:1901564	0.603	organonitrogen compound metabolic process
GO:0031326	0.569	regulation of cellular biosynthetic process
GO:0051246	0.542	regulation of protein metabolic process
GO:0019219	0.538	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.528	regulation of macromolecule biosynthetic process
GO:0009891	0.515	positive regulation of biosynthetic process
GO:0043412	0.487	macromolecule modification
GO:0051252	0.472	regulation of RNA metabolic process
GO:0006355	0.456	regulation of DNA-templated transcription
GO:0048584	0.448	positive regulation of response to stimulus
GO:0045595	0.448	regulation of cell differentiation
GO:0023056	0.448	positive regulation of signaling
GO:0010647	0.448	positive regulation of cell communication
GO:0009653	0.445	anatomical structure morphogenesis
GO:0009967	0.440	positive regulation of signal transduction
GO:0031328	0.437	positive regulation of cellular biosynthetic process
GO:0045935	0.426	positive regulation of nucleobase-containing compound metabolic process
GO:0071840	0.424	cellular component organization or biogenesis
GO:0010557	0.423	positive regulation of macromolecule biosynthetic process
GO:0019538	0.421	protein metabolic process
GO:0010941	0.419	regulation of cell death
GO:0031399	0.416	regulation of protein modification process
GO:0009892	0.400	negative regulation of metabolic process
GO:0009888	0.396	tissue development
GO:0036211	0.361	protein modification process
GO:0016043	0.355	cellular component organization
GO:0042325	0.352	regulation of phosphorylation
GO:0051247	0.351	positive regulation of protein metabolic process
GO:0010605	0.331	negative regulation of macromolecule metabolic process
GO:0006950	0.324	response to stress
GO:1903508	0.320	positive regulation of nucleic acid-templated transcription
GO:0065009	0.316	regulation of molecular function
GO:0051240	0.313	positive regulation of multicellular organismal process
GO:0045893	0.309	positive regulation of DNA-templated transcription
GO:0051128	0.300	regulation of cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0032991	0.934	protein-containing complex
GO:0005622	0.930	intracellular anatomical structure
GO:0005829	0.920	cytosol
GO:0043231	0.844	intracellular membrane-bounded organelle
GO:0005634	0.607	nucleus
GO:0031982	0.476	vesicle
GO:0070013	0.426	intracellular organelle lumen
GO:0097708	0.408	intracellular vesicle
GO:0012505	0.332	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:18673	0.996	ATP + L-seryl-[receptor-protein] = ADP + H(+) + O-phospho-L-seryl-[receptor-protein]
EC:2.7.11.30	0.996	receptor protein serine/threonine kinase.

[back to server]