StarFunc result for job id P36941

User Input

>input (435 residues)
MLLPWATSAPGLAWGPLVLGLFGLLAASQPQAVPPYASENQTCRDQEKEYYEPQHRICCS
RCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKR
KTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSS
PSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLMLAVLLPLAFFLLL
ATVFSCIWKSHPSLCRKLGSLLKRRPQGEGPNPVAGSWEPPKAHPYFPDLVQPLLPISGD
VSPVSTGLPAAPVLEAGVPQQQSPLDLTREPQLEPGEQSQVAHGTNGIHVTGGSMTITGN
IYIYNGPVLGGPPGPGDLPATPEPPYPIPEEGDPGPPGLSTPHQEDGKAWHLAETEHCGA
TPSNRGPRNQFITHD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P36941	1.000	1.000	3.725E-75	435	1.000	1.000	P36941.pdb.gz	TNR3_HUMAN Tumor necrosis factor receptor superfamily member 3 OS=Homo sapiens OX=9606 GN=LTBR PE=1 SV=1
2	AFDB:P50284	0.454	0.472	4.910E-51	415	0.660	0.692	P50284.pdb.gz	TNR3_MOUSE Tumor necrosis factor receptor superfamily member 3 OS=Mus musculus OX=10090 GN=Ltbr PE=1 SV=1
3	AFDB:F5H2E7	0.252	0.369	6.232E-40	292	0.671	1.000	F5H2E7.pdb.gz	F5H2E7_HUMAN Lymphotoxin beta receptor OS=Homo sapiens OX=9606 GN=LTBR PE=1 SV=1
4	AFDB:F1RAS9	0.352	0.359	4.517E-22	425	0.232	0.238	F1RAS9.pdb.gz	F1RAS9_DANRE Tumor necrosis factor receptor superfamily, member 1B OS=Danio rerio OX=7955 GN=tnfrsf1b PE=4 SV=2
5	AFDB:Q80WY6	0.349	0.322	1.111E-20	474	0.241	0.222	Q80WY6.pdb.gz	TNR1B_RAT Tumor necrosis factor receptor superfamily member 1B OS=Rattus norvegicus OX=10116 GN=Tnfrsf1b PE=2 SV=1
6	AFDB:F1M8Z6	0.358	0.253	2.338E-20	633	0.264	0.182	F1M8Z6.pdb.gz	F1M8Z6_RAT TNF receptor superfamily member 11A OS=Rattus norvegicus OX=10116 GN=Tnfrsf11a PE=4 SV=2
7	AFDB:P25119	0.339	0.313	1.228E-19	474	0.257	0.236	P25119.pdb.gz	TNR1B_MOUSE Tumor necrosis factor receptor superfamily member 1B OS=Mus musculus OX=10090 GN=Tnfrsf1b PE=2 SV=1
8	AFDB:Q71F55	0.302	0.449	8.336E-17	276	0.189	0.297	Q71F55.pdb.gz	Q71F55_MOUSE Herpes virus entry mediator OS=Mus musculus OX=10090 GN=Tnfrsf14 PE=1 SV=1
9	AFDB:Q92956	0.234	0.334	3.792E-14	283	0.161	0.247	Q92956.pdb.gz	TNR14_HUMAN Tumor necrosis factor receptor superfamily member 14 OS=Homo sapiens OX=9606 GN=TNFRSF14 PE=1 SV=3
10	AFDB:P28908	0.172	0.132	4.487E-6	595	0.223	0.163	P28908.pdb.gz	TNR8_HUMAN Tumor necrosis factor receptor superfamily member 8 OS=Homo sapiens OX=9606 GN=TNFRSF8 PE=1 SV=1
11	PDB:8e4cC	0.075	0.141	2.654	142	0.057	0.176	8e4cC.pdb.gz
12	PDB:7wihA	0.093	0.060	6.627	741	0.030	0.018	7wihA.pdb.gz	Structural basis of the activation of metabotropic glutamate receptor 3.
13	PDB:3h7cX	0.045	0.051	7.017	369	0.016	0.019	3h7cX.pdb.gz	Structural Insights into the Catalytic Mechanism of Arabidopsis thaliana Agmatine Deiminase
14	PDB:7wtbB	0.053	0.027	7.868	1147	0.028	0.010	7wtbB.pdb.gz	Mechanistic insight into allosteric activation of human pyruvate carboxylase by acetyl-CoA.
15	PDB:4v8mBj	0.085	0.185	9.340	161	0.028	0.075	4v8mBj.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
16	PDB:6oemB	0.052	0.060	9.340	346	0.032	0.040	6oemB.pdb.gz	Cutting antiparallel DNA strands in a single active site.
17	PDB:1griA	0.055	0.093	9.890	211	0.016	0.033	1griA.pdb.gz
18	PDB:7abgv	0.060	0.194	9.890	119	0.025	0.092	7abgv.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
19	PDB:7uhyA	0.053	0.036	9.890	771	0.030	0.017	7uhyA.pdb.gz	Structure of the nutrient-sensing hub GATOR2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F5H2E7	0.0	572	292	0.671	1.000	F5H2E7_HUMAN Lymphotoxin beta receptor OS=Homo sapiens OX=9606 GN=LTBR PE=1 SV=1
2	P36941	0.0	884	435	1.000	1.000	TNR3_HUMAN Tumor necrosis factor receptor superfamily member 3 OS=Homo sapiens OX=9606 GN=LTBR PE=1 SV=1
3	P50284	1.60e-165	473	415	0.660	0.692	TNR3_MOUSE Tumor necrosis factor receptor superfamily member 3 OS=Mus musculus OX=10090 GN=Ltbr PE=1 SV=1
4	F5H6F8	1.75e-156	442	217	0.499	1.000	F5H6F8_HUMAN Lymphotoxin beta receptor (Fragment) OS=Homo sapiens OX=9606 GN=LTBR PE=1 SV=8
5	F1RAS9	4.59e-26	111	425	0.156	0.160	F1RAS9_DANRE Tumor necrosis factor receptor superfamily, member 1B OS=Danio rerio OX=7955 GN=tnfrsf1b PE=4 SV=2
6	P25942	2.48e-24	103	277	0.207	0.325	TNR5_HUMAN Tumor necrosis factor receptor superfamily member 5 OS=Homo sapiens OX=9606 GN=CD40 PE=1 SV=1
7	O35305	2.42e-23	105	625	0.145	0.101	TNR11_MOUSE Tumor necrosis factor receptor superfamily member 11A OS=Mus musculus OX=10090 GN=Tnfrsf11a PE=1 SV=1
8	P20333	9.42e-23	102	461	0.168	0.158	TNR1B_HUMAN Tumor necrosis factor receptor superfamily member 1B OS=Homo sapiens OX=9606 GN=TNFRSF1B PE=1 SV=3
9	P25119	2.48e-22	101	474	0.131	0.120	TNR1B_MOUSE Tumor necrosis factor receptor superfamily member 1B OS=Mus musculus OX=10090 GN=Tnfrsf1b PE=2 SV=1
10	F1M8Z6	1.34e-21	99.8	633	0.136	0.093	F1M8Z6_RAT TNF receptor superfamily member 11A OS=Rattus norvegicus OX=10116 GN=Tnfrsf11a PE=4 SV=2
11	Q80WY6	1.85e-21	98.6	474	0.154	0.141	TNR1B_RAT Tumor necrosis factor receptor superfamily member 1B OS=Rattus norvegicus OX=10116 GN=Tnfrsf1b PE=2 SV=1
12	Q9Y6Q6	1.41e-20	96.7	616	0.154	0.109	TNR11_HUMAN Tumor necrosis factor receptor superfamily member 11A OS=Homo sapiens OX=9606 GN=TNFRSF11A PE=1 SV=1
13	F6SVZ3	8.22e-19	88.2	269	0.126	0.204	F6SVZ3_RAT Tumor necrosis factor receptor superfamily member 5 OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1
14	A0A8I6AHI1	1.77e-18	87.8	309	0.140	0.197	A0A8I6AHI1_RAT Tumor necrosis factor receptor superfamily member 5 OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1
15	A0A8I6A4J5	2.25e-18	86.7	260	0.145	0.242	A0A8I6A4J5_RAT Tumor necrosis factor receptor superfamily member 5 OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1
16	O95407	4.51e-18	86.7	300	0.166	0.240	TNF6B_HUMAN Tumor necrosis factor receptor superfamily member 6B OS=Homo sapiens OX=9606 GN=TNFRSF6B PE=1 SV=1
17	Q80WM9	3.93e-17	83.2	275	0.143	0.225	TNR14_MOUSE Tumor necrosis factor receptor superfamily member 14 OS=Mus musculus OX=10090 GN=Tnfrsf14 PE=1 SV=1
18	Q71F55	4.35e-17	83.2	276	0.143	0.225	Q71F55_MOUSE Herpes virus entry mediator OS=Mus musculus OX=10090 GN=Tnfrsf14 PE=1 SV=1
19	P27512	6.15e-15	77.0	289	0.133	0.201	TNR5_MOUSE Tumor necrosis factor receptor superfamily member 5 OS=Mus musculus OX=10090 GN=Cd40 PE=1 SV=3
20	O00300	2.39e-14	76.6	401	0.115	0.125	TR11B_HUMAN Tumor necrosis factor receptor superfamily member 11B OS=Homo sapiens OX=9606 GN=TNFRSF11B PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15664 TMEM252	3.8e+02	12.2	Transmembrane protein 252 family
2	PF00020 TNFR_c6	1.3e-20	84.9	TNFR/NGFR cysteine-rich region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000228918

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000454207	0.999	TNF receptor-associated factor 3
2	9606.ENSP00000469049	0.998	Tumor necrosis factor ligand superfamily member 14
3	9606.ENSP00000410481	0.995	Lymphotoxin-beta
4	9606.ENSP00000403495	0.992	Lymphotoxin-alpha
5	9606.ENSP00000261464	0.990	TNF receptor-associated factor 5
6	9606.ENSP00000247668	0.985	TNF receptor-associated factor 2
7	9606.ENSP00000398698	0.940	Tumor necrosis factor
8	9606.ENSP00000482657	0.896	Mitogen-activated protein kinase kinase kinase 14
9	9606.ENSP00000477613	0.885	Baculoviral IAP repeat-containing protein 2
10	9606.ENSP00000291232	0.869	Tumor necrosis factor receptor superfamily member 13C
11	9606.ENSP00000365048	0.840	Tumor necrosis factor ligand superfamily member 13B
12	9606.ENSP00000263464	0.831	Baculoviral IAP repeat-containing protein 3
13	9606.ENSP00000381775	0.807	Tumor necrosis factor ligand superfamily member 11
14	9606.ENSP00000326737	0.804	Tumor necrosis factor receptor superfamily member 12A
15	9606.ENSP00000162749	0.798	Tumor necrosis factor receptor superfamily member 1A
16	9606.ENSP00000359663	0.798	CD40 ligand
17	9606.ENSP00000362994	0.795	TNF receptor-associated factor 1
18	9606.ENSP00000358983	0.781	Nuclear factor NF-kappa-B p100 subunit
19	9606.ENSP00000262395	0.777	TNF receptor-associated factor 4
20	9606.ENSP00000293825	0.755	Tumor necrosis factor ligand superfamily member 12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.985	enzyme binding
GO:0042802	0.972	identical protein binding
GO:0031625	0.939	ubiquitin protein ligase binding
GO:0038023	0.774	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050896	0.995	response to stimulus
GO:0023052	0.990	signaling
GO:0051716	0.990	cellular response to stimulus
GO:0050794	0.989	regulation of cellular process
GO:0048583	0.989	regulation of response to stimulus
GO:0007154	0.988	cell communication
GO:0023056	0.984	positive regulation of signaling
GO:0010647	0.984	positive regulation of cell communication
GO:1902531	0.984	regulation of intracellular signal transduction
GO:0048584	0.983	positive regulation of response to stimulus
GO:0042981	0.980	regulation of apoptotic process
GO:0007165	0.975	signal transduction
GO:0009967	0.967	positive regulation of signal transduction
GO:0080134	0.950	regulation of response to stress
GO:0043122	0.928	regulation of I-kappaB kinase/NF-kappaB signaling
GO:1902533	0.928	positive regulation of intracellular signal transduction
GO:0009605	0.926	response to external stimulus
GO:2001233	0.845	regulation of apoptotic signaling pathway
GO:0043408	0.775	regulation of MAPK cascade
GO:2001236	0.762	regulation of extrinsic apoptotic signaling pathway
GO:0019222	0.753	regulation of metabolic process
GO:0060255	0.739	regulation of macromolecule metabolic process
GO:0043123	0.705	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0010942	0.675	positive regulation of cell death
GO:0043065	0.671	positive regulation of apoptotic process
GO:0080135	0.667	regulation of cellular response to stress
GO:0104004	0.616	cellular response to environmental stimulus
GO:0080090	0.562	regulation of primary metabolic process
GO:0051171	0.562	regulation of nitrogen compound metabolic process
GO:2001235	0.492	positive regulation of apoptotic signaling pathway
GO:0031323	0.474	regulation of cellular metabolic process
GO:0002376	0.470	immune system process
GO:0070302	0.460	regulation of stress-activated protein kinase signaling cascade
GO:0043410	0.421	positive regulation of MAPK cascade
GO:0032501	0.414	multicellular organismal process
GO:0009893	0.408	positive regulation of metabolic process
GO:0010468	0.402	regulation of gene expression
GO:0032502	0.376	developmental process
GO:0071260	0.374	cellular response to mechanical stimulus
GO:2001238	0.372	positive regulation of extrinsic apoptotic signaling pathway
GO:0048856	0.370	anatomical structure development
GO:0010604	0.368	positive regulation of macromolecule metabolic process
GO:0042221	0.346	response to chemical
GO:0048519	0.343	negative regulation of biological process
GO:0046328	0.342	regulation of JNK cascade
GO:0007166	0.338	cell surface receptor signaling pathway
GO:0032874	0.333	positive regulation of stress-activated MAPK cascade
GO:0010033	0.327	response to organic substance
GO:0065009	0.309	regulation of molecular function
GO:0070887	0.305	cellular response to chemical stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	0.999	plasma membrane
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0012505	0.995	endomembrane system
GO:0005794	0.888	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]