StarFunc result for job id P36954

User Input

>input (125 residues)
MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITH
EVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCG
HRWTE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P36954	1.000	1.000	2.177E-23	125	1.000	1.000	P36954.pdb.gz	RPB9_HUMAN DNA-directed RNA polymerase II subunit RPB9 OS=Homo sapiens OX=9606 GN=POLR2I PE=1 SV=1
2	AFDB:P36958	0.901	0.875	1.968E-18	129	0.744	0.721	P36958.pdb.gz	RPB9_DROME DNA-directed RNA polymerase II subunit RPB9 OS=Drosophila melanogaster OX=7227 GN=RpII15 PE=2 SV=2
3	PDB:5iy6I	0.875	0.875	4.220E-18	125	1.000	1.000	5iy6I.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
4	AFDB:Q6NLH0	0.432	0.468	1.942E-15	114	0.568	0.623	Q6NLH0.pdb.gz	RPB9A_ARATH DNA-directed RNA polymerases II, IV and V subunit 9A OS=Arabidopsis thaliana OX=3702 GN=NRPB9A PE=1 SV=1
5	PDB:7eu0I	0.359	0.396	6.511E-13	113	0.568	0.628	7eu0I.pdb.gz	Pol IV and RDR2: A two-RNA-polymerase machine that produces double-stranded RNA.
6	AFDB:O74635	0.803	0.881	5.264E-12	113	0.424	0.469	O74635.pdb.gz	RPB9_SCHPO DNA-directed RNA polymerase II subunit RPB9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpb9 PE=1 SV=1
7	AFDB:P27999	0.808	0.826	9.537E-12	122	0.392	0.402	P27999.pdb.gz	RPB9_YEAST DNA-directed RNA polymerase II subunit RPB9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPB9 PE=1 SV=1
8	PDB:1i3qI	0.748	0.764	4.773E-10	122	0.392	0.402	1i3qI.pdb.gz	Structural basis of transcription: RNA polymerase II at 2.8 angstrom resolution.
9	PDB:3h0gI	0.759	0.843	9.741E-10	111	0.424	0.477	3h0gI.pdb.gz	Schizosacharomyces pombe RNA polymerase II at 3.6-A resolution.
10	AFDB:Q384T7	0.731	0.694	1.176E-9	133	0.288	0.271	Q384T7.pdb.gz	Q384T7_TRYB2 DNA-direcetd RNA polymerase II, subunit 9, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.5180 PE=4 SV=1
11	AFDB:Q6DGU0	0.374	0.427	2.331E-7	108	0.264	0.306	Q6DGU0.pdb.gz	Q6DGU0_DANRE DNA-directed RNA polymerase subunit OS=Danio rerio OX=7955 GN=zgc:92774 PE=2 SV=1
12	AFDB:Q980K2	0.377	0.407	6.795E-7	114	0.232	0.254	Q980K2.pdb.gz	TFS1_SACS2 Transcription factor S1 OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=tfs1 PE=1 SV=1
13	AFDB:Q04307	0.326	0.365	8.619E-7	110	0.288	0.327	Q04307.pdb.gz	RPC10_YEAST DNA-directed RNA polymerase III subunit RPC10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPC11 PE=1 SV=1
14	PDB:7z1lI	0.331	0.369	5.718E-6	110	0.296	0.336	7z1lI.pdb.gz	Architecture of the yeast Pol III pre-termination complex and pausing mechanism on poly(dT) termination signals.
15	AFDB:A0A384LJI7	0.338	0.391	7.771E-6	106	0.216	0.255	A0A384LJI7.pdb.gz	A0A384LJI7_ARATH DNA-directed RNA polymerase subunit OS=Arabidopsis thaliana OX=3702 GN=At1g01210 PE=1 SV=1
16	PDB:7d59I	0.328	0.371	2.681E-5	108	0.240	0.278	7d59I.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
17	PDB:5fj9I	0.286	0.371	3.205E-5	92	0.264	0.359	5fj9I.pdb.gz	Molecular Structures of Unbound and Transcribing RNA Polymerase III.
18	PDB:4c2mI	0.321	0.323	3.255E-4	124	0.176	0.177	4c2mI.pdb.gz	RNA Polymerase I Structure and Transcription Regulation.
19	PDB:6hlqI	0.271	0.301	3.950E-3	111	0.208	0.234	6hlqI.pdb.gz	The cryo-EM structure of a 12-subunit variant of RNA polymerase I reveals dissociation of the A49-A34.5 heterodimer and rearrangement of subunit A12.2.
20	PDB:5n5yI	0.222	0.271	4.449E-3	99	0.152	0.192	5n5yI.pdb.gz	Structural Basis of RNA Polymerase I Transcription Initiation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P36954	2.35e-93	266	125	1.000	1.000	RPB9_HUMAN DNA-directed RNA polymerase II subunit RPB9 OS=Homo sapiens OX=9606 GN=POLR2I PE=1 SV=1
2	P60898	2.35e-93	266	125	1.000	1.000	RPB9_MOUSE DNA-directed RNA polymerase II subunit RPB9 OS=Mus musculus OX=10090 GN=Polr2i PE=1 SV=1
3	P36958	1.70e-68	204	129	0.736	0.713	RPB9_DROME DNA-directed RNA polymerase II subunit RPB9 OS=Drosophila melanogaster OX=7227 GN=RpII15 PE=2 SV=2
4	Q6NLH0	4.28e-51	159	114	0.568	0.623	RPB9A_ARATH DNA-directed RNA polymerases II, IV and V subunit 9A OS=Arabidopsis thaliana OX=3702 GN=NRPB9A PE=1 SV=1
5	Q8L5V0	5.80e-49	154	114	0.552	0.605	RPB9B_ARATH DNA-directed RNA polymerases II, IV and V subunit 9B OS=Arabidopsis thaliana OX=3702 GN=NRPB9B PE=1 SV=1
6	P27999	3.69e-31	109	122	0.400	0.410	RPB9_YEAST DNA-directed RNA polymerase II subunit RPB9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPB9 PE=1 SV=1
7	O74635	9.46e-30	105	113	0.432	0.478	RPB9_SCHPO DNA-directed RNA polymerase II subunit RPB9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpb9 PE=1 SV=1
8	Q384T7	3.42e-15	68.9	133	0.288	0.271	Q384T7_TRYB2 DNA-direcetd RNA polymerase II, subunit 9, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.5180 PE=4 SV=1
9	Q980K2	1.19e-12	61.6	114	0.272	0.298	TFS1_SACS2 Transcription factor S1 OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=tfs1 PE=1 SV=1
10	Q6DGU0	1.71e-09	53.5	108	0.280	0.324	Q6DGU0_DANRE DNA-directed RNA polymerase subunit OS=Danio rerio OX=7955 GN=zgc:92774 PE=2 SV=1
11	Q56254	2.65e-09	53.1	110	0.264	0.300	TFS_THECE Transcription factor S OS=Thermococcus celer OX=2264 GN=tfs PE=1 SV=1
12	Q04307	1.60e-08	50.8	110	0.264	0.300	RPC10_YEAST DNA-directed RNA polymerase III subunit RPC10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPC11 PE=1 SV=1
13	Q9Y2Y1	1.32e-07	48.5	108	0.240	0.278	RPC10_HUMAN DNA-directed RNA polymerase III subunit RPC10 OS=Homo sapiens OX=9606 GN=POLR3K PE=1 SV=3
14	Q9P9I8	3.13e-06	44.7	105	0.280	0.333	TFS_METTL Transcription factor S OS=Methanothermococcus thermolithotrophicus OX=2186 GN=tfs PE=3 SV=1
15	A0A384LJI7	0.005	36.2	106	0.224	0.264	A0A384LJI7_ARATH DNA-directed RNA polymerase subunit OS=Arabidopsis thaliana OX=3702 GN=At1g01210 PE=1 SV=1
16	Q9ZQC0	0.006	36.2	106	0.224	0.264	Q9ZQC0_ARATH DNA-directed RNA polymerase subunit OS=Arabidopsis thaliana OX=3702 GN=At4g07950 PE=1 SV=1
17	O13896	0.081	33.1	109	0.248	0.284	RPC10_SCHPO DNA-directed RNA polymerase III subunit RPC10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpc11 PE=3 SV=1
18	Q9ZVH8	0.51	32.0	378	0.088	0.029	RDO2_ARATH Transcription elongation factor TFIIS OS=Arabidopsis thaliana OX=3702 GN=TFIIS PE=1 SV=1
19	A0A1W2PPZ5	0.81	31.2	301	0.112	0.047	A0A1W2PPZ5_HUMAN Transcription elongation factor (Fragment) OS=Homo sapiens OX=9606 GN=TCEA1 PE=1 SV=1
20	P10711	0.81	31.2	301	0.112	0.047	TCEA1_MOUSE Transcription elongation factor A protein 1 OS=Mus musculus OX=10090 GN=Tcea1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12511 DUF3716	6.4e+02	11.8	Protein of unknown function (DUF3716)
2	PF12773 DZR	23	16.4	Double zinc ribbon
3	PF04606 Ogr_Delta	1.1e+02	14.2	Ogr/Delta-like zinc finger
4	PF02150 RNA_POL_M_15KD	1.4e-13	61.7	RNA polymerases M/15 Kd subunit
5	PF01096 TFIIS_C	6.2e-09	46.9	Transcription factor S-II (TFIIS)
6	PF13408 Zn_ribbon_recom	0.02	26.7	Recombinase zinc beta ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 885580.XP_010630186.1

Rank	PPI partner	STRING score	Description
1	885580.XP_010607824.1	0.999	DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.
2	885580.XP_010611442.1	0.999	DNA-directed RNA polymerases I, II, and III subunit RPABC2
3	885580.XP_010613165.1	0.999	DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.
4	885580.XP_010631277.1	0.999	DNA-directed RNA polymerase II subunit RPB7
5	885580.XP_010633257.1	0.999	DNA-directed RNA polymerases I, II, and III subunit RPABC1 isoform X1
6	885580.XP_010637190.1	0.999	DNA-directed RNA polymerase II subunit RPB3
7	885580.XP_010617254.1	0.998	DNA-directed RNA polymerase II subunit RPB11-a
8	885580.XP_010617851.1	0.998	DNA-directed RNA polymerases I, II, and III subunit RPABC4
9	885580.XP_010635941.1	0.998	DNA-directed RNA polymerase II subunit RPB4
10	885580.XP_010638676.1	0.998	DNA-directed RNA polymerases I, II, and III subunit RPABC5
11	885580.XP_010622549.1	0.997	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 16 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 16 samples with support for all annotated introns
12	885580.XP_010635351.1	0.989	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 9 samples with support for all annotated introns
13	885580.XP_010633073.1	0.987	General transcription factor IIF subunit 1 isoform X1
14	885580.XP_010618552.1	0.980	Transcription elongation factor SPT4 isoform X1
15	885580.XP_010622850.1	0.975	UBX domain-containing protein 7
16	885580.XP_010634971.1	0.971	Transcription initiation factor IIB
17	885580.XP_010628308.1	0.970	General transcription factor IIE subunit 1
18	885580.XP_010612810.1	0.969	Transcription elongation factor SPT5 isoform X1
19	885580.XP_010607381.1	0.963	RNA polymerase-associated protein LEO1
20	885580.XP_010620371.1	0.950	Recruits TFIIH to the initiation complex and stimulates the RNA polymerase II C-terminal domain kinase and DNA-dependent ATPase activities of TFIIH. Both TFIIH and TFIIE are required for promoter clearance by RNA polymerase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008270	1.000	zinc ion binding
GO:0003899	0.999	DNA-directed 5'-3' RNA polymerase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.984	organic substance metabolic process
GO:0044238	0.983	primary metabolic process
GO:0044237	0.982	cellular metabolic process
GO:0006351	0.974	DNA-templated transcription
GO:0006366	0.739	transcription by RNA polymerase II
GO:0065007	0.517	biological regulation
GO:0050789	0.502	regulation of biological process
GO:0019222	0.305	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0140513	0.996	nuclear protein-containing complex
GO:1990234	0.995	transferase complex
GO:0140535	0.992	intracellular protein-containing complex
GO:0061695	0.984	transferase complex, transferring phosphorus-containing groups
GO:0055029	0.968	nuclear DNA-directed RNA polymerase complex
GO:0016591	0.913	RNA polymerase II, holoenzyme
GO:0005665	0.902	RNA polymerase II, core complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.7.6	0.999	DNA-directed RNA polymerase.

[back to server]