StarFunc result for job id P36955

User Input

>input (418 residues)
MQALVLLLCIGALLGHSSCQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSN
FGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHG
TYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEI
NNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVR
VPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHD
IDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRA
GFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P36955	1.000	1.000	1.330E-88	418	1.000	1.000	P36955.pdb.gz	PEDF_HUMAN Pigment epithelium-derived factor OS=Homo sapiens OX=9606 GN=SERPINF1 PE=1 SV=4
2	AFDB:Q95121	0.944	0.948	1.687E-80	416	0.873	0.877	Q95121.pdb.gz	PEDF_BOVIN Pigment epithelium-derived factor OS=Bos taurus OX=9913 GN=SERPINF1 PE=1 SV=1
3	AFDB:Q80ZA3	0.938	0.938	7.372E-79	418	0.825	0.825	Q80ZA3.pdb.gz	Q80ZA3_RAT Serine (Or cysteine) peptidase inhibitor, clade F, member 1 OS=Rattus norvegicus OX=10116 GN=Serpinf1 PE=2 SV=1
4	PDB:1imvA	0.892	0.994	8.861E-74	375	0.890	0.992	1imvA.pdb.gz
5	PDB:6losA	0.868	0.983	1.792E-70	369	0.773	0.875	6losA.pdb.gz	Spatiotemporal regulation of PEDF signaling by type I collagen remodeling.
6	AFDB:P07758	0.809	0.818	1.218E-38	413	0.256	0.259	P07758.pdb.gz	A1AT1_MOUSE Alpha-1-antitrypsin 1-1 OS=Mus musculus OX=10090 GN=Serpina1a PE=1 SV=4
7	AFDB:Q9UK55	0.814	0.768	1.717E-38	444	0.258	0.243	Q9UK55.pdb.gz	ZPI_HUMAN Protein Z-dependent protease inhibitor OS=Homo sapiens OX=9606 GN=SERPINA10 PE=1 SV=1
8	AFDB:P07759	0.817	0.817	2.286E-38	418	0.278	0.278	P07759.pdb.gz	SPA3K_MOUSE Serine protease inhibitor A3K OS=Mus musculus OX=10090 GN=Serpina3k PE=1 SV=2
9	AFDB:Q80X76	0.812	0.764	2.421E-38	445	0.289	0.272	Q80X76.pdb.gz	SPA3F_MOUSE Serine protease inhibitor A3F OS=Mus musculus OX=10090 GN=Serpina3f PE=1 SV=3
10	AFDB:P08697	0.815	0.699	4.052E-38	491	0.278	0.236	P08697.pdb.gz	A2AP_HUMAN Alpha-2-antiplasmin OS=Homo sapiens OX=9606 GN=SERPINF2 PE=1 SV=3
11	AFDB:P17475	0.806	0.819	5.394E-38	411	0.258	0.263	P17475.pdb.gz	A1AT_RAT Alpha-1-antiproteinase OS=Rattus norvegicus OX=10116 GN=Serpina1 PE=1 SV=2
12	AFDB:P20848	0.792	0.789	9.561E-38	420	0.234	0.233	P20848.pdb.gz	A1ATR_HUMAN Alpha-1-antitrypsin-related protein OS=Homo sapiens OX=9606 GN=SERPINA2 PE=1 SV=2
13	PDB:1jmoA	0.818	0.801	3.068E-37	427	0.225	0.220	1jmoA.pdb.gz
14	PDB:3f1sA	0.806	0.872	4.849E-37	385	0.234	0.255	3f1sA.pdb.gz
15	PDB:2r9yA	0.778	0.886	1.439E-36	365	0.263	0.301	2r9yA.pdb.gz
16	PDB:1yxaA	0.776	0.868	4.519E-36	372	0.254	0.285	1yxaA.pdb.gz
17	PDB:1hp7A	0.788	0.871	5.067E-36	376	0.244	0.271	1hp7A.pdb.gz	A 2.1 A resolution structure of an uncleaved alpha(1)-antitrypsin shows variability of the reactive center and other loops.
18	PDB:2ol2A	0.763	0.880	6.287E-35	360	0.227	0.264	2ol2A.pdb.gz
19	PDB:7npkA	0.752	0.886	2.630E-34	352	0.237	0.281	7npkA.pdb.gz	The development of highly potent and selective small molecule correctors of Z alpha 1 -antitrypsin misfolding.
20	PDB:4dy7F	0.808	0.889	4.401E-34	378	0.201	0.222	4dy7F.pdb.gz	Crystal structures of protease nexin-1 in complex with heparin and thrombin suggest a 2-step recognition mechanism.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8J8XL70	0.0	694	411	0.813	0.827	A0A8J8XL70_RAT Serpin family F member 1 OS=Rattus norvegicus OX=10116 GN=Serpinf1 PE=1 SV=1
2	P36955	0.0	853	418	1.000	1.000	PEDF_HUMAN Pigment epithelium-derived factor OS=Homo sapiens OX=9606 GN=SERPINF1 PE=1 SV=4
3	P97298	0.0	745	417	0.861	0.863	PEDF_MOUSE Pigment epithelium-derived factor OS=Mus musculus OX=10090 GN=Serpinf1 PE=1 SV=2
4	Q80ZA3	0.0	717	418	0.830	0.830	Q80ZA3_RAT Serine (Or cysteine) peptidase inhibitor, clade F, member 1 OS=Rattus norvegicus OX=10116 GN=Serpinf1 PE=2 SV=1
5	Q95121	0.0	748	416	0.873	0.877	PEDF_BOVIN Pigment epithelium-derived factor OS=Bos taurus OX=9913 GN=SERPINF1 PE=1 SV=1
6	A0A8I6GIT3	1.42e-69	218	148	0.273	0.770	A0A8I6GIT3_RAT Serpin family F member 1 OS=Rattus norvegicus OX=10116 GN=Serpinf1 PE=1 SV=1
7	Q68FT8	1.28e-53	187	491	0.280	0.238	Q68FT8_RAT RCG33981, isoform CRA_a OS=Rattus norvegicus OX=10116 GN=Serpinf2 PE=2 SV=1
8	Q61247	5.63e-53	186	491	0.273	0.232	A2AP_MOUSE Alpha-2-antiplasmin OS=Mus musculus OX=10090 GN=Serpinf2 PE=1 SV=1
9	F7FHF3	6.63e-53	187	554	0.280	0.211	F7FHF3_RAT Serpin family F member 2 OS=Rattus norvegicus OX=10116 GN=Serpinf2 PE=1 SV=1
10	A0A8I6AQI7	6.89e-53	187	561	0.280	0.209	A0A8I6AQI7_RAT Serpin family F member 2 OS=Rattus norvegicus OX=10116 GN=Serpinf2 PE=1 SV=1
11	P08697	2.52e-49	176	491	0.261	0.222	A2AP_HUMAN Alpha-2-antiplasmin OS=Homo sapiens OX=9606 GN=SERPINF2 PE=1 SV=3
12	Q80X76	9.94e-48	171	445	0.292	0.274	SPA3F_MOUSE Serine protease inhibitor A3F OS=Mus musculus OX=10090 GN=Serpina3f PE=1 SV=3
13	D3Z450	1.09e-44	162	408	0.266	0.272	D3Z450_MOUSE Serine (or cysteine) peptidase inhibitor, clade A, member 3I OS=Mus musculus OX=10090 GN=Serpina3i PE=1 SV=2
14	E9KL23	7.32e-44	160	418	0.280	0.280	E9KL23_HUMAN Epididymis secretory sperm binding protein Li 44a OS=Homo sapiens OX=9606 GN=SERPINA1 PE=2 SV=1
15	P01009	7.32e-44	160	418	0.280	0.280	A1AT_HUMAN Alpha-1-antitrypsin OS=Homo sapiens OX=9606 GN=SERPINA1 PE=1 SV=3
16	Q5SV42	3.00e-42	154	375	0.251	0.280	ILEUC_MOUSE Leukocyte elastase inhibitor C OS=Mus musculus OX=10090 GN=Serpinb1c PE=1 SV=1
17	Q7TMF5	5.06e-42	155	413	0.251	0.254	SPA12_MOUSE Serpin A12 OS=Mus musculus OX=10090 GN=Serpina12 PE=1 SV=2
18	A0A0G2JSK1	6.02e-42	154	416	0.270	0.272	A0A0G2JSK1_RAT Serine (or cysteine) proteinase inhibitor, clade A, member 3C OS=Rattus norvegicus OX=10116 GN=Serpina3c PE=3 SV=1
19	P17475	1.01e-41	154	411	0.251	0.255	A1AT_RAT Alpha-1-antiproteinase OS=Rattus norvegicus OX=10116 GN=Serpina1 PE=1 SV=2
20	P08185	2.94e-41	152	405	0.256	0.264	CBG_HUMAN Corticosteroid-binding globulin OS=Homo sapiens OX=9606 GN=SERPINA6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00079 Serpin	7.2e-78	274.1	Serpin (serine protease inhibitor)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000254722

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261349	0.872	Low-density lipoprotein receptor-related protein 6
2	9606.ENSP00000337701	0.860	Patatin-like phospholipase domain-containing protein 2
3	9606.ENSP00000294304	0.843	Low-density lipoprotein receptor-related protein 5
4	9606.ENSP00000236040	0.815	Prolyl 3-hydroxylase 1
5	9606.ENSP00000317232	0.799	Peptidyl-prolyl cis-trans isomerase FKBP10
6	9606.ENSP00000372059	0.777	Interferon-induced transmembrane protein 5
7	9606.ENSP00000323696	0.752	Cartilage-associated protein
8	9606.ENSP00000363824	0.742	Trimeric intracellular cation channel type B
9	9606.ENSP00000225964	0.714	Collagen alpha-1(I) chain
10	9606.ENSP00000282903	0.688	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2
11	9606.ENSP00000297268	0.647	Collagen alpha-2(I) chain
12	9606.ENSP00000406027	0.626	EPM2A interacting protein 1
13	9606.ENSP00000478570	0.614	Vascular endothelial growth factor A
14	9606.ENSP00000220809	0.608	Tissue-type plasminogen activator
15	9606.ENSP00000360687	0.605	Prostaglandin-H2 D-isomerase
16	9606.ENSP00000316809	0.573	Phosphatidylinositol transfer protein alpha isoform
17	9606.ENSP00000262340	0.570	Retinoid isomerohydrolase
18	9606.ENSP00000300026	0.561	Peptidyl-prolyl cis-trans isomerase B
19	9606.ENSP00000368798	0.561	Membrane-bound transcription factor site-2 protease
20	9606.ENSP00000263071	0.550	Scavenger receptor class F member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004867	1.000	serine-type endopeptidase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048519	0.995	negative regulation of biological process
GO:0022603	0.995	regulation of anatomical structure morphogenesis
GO:2000026	0.995	regulation of multicellular organismal development
GO:1901342	0.992	regulation of vasculature development
GO:0050794	0.984	regulation of cellular process
GO:0016525	0.965	negative regulation of angiogenesis
GO:0032501	0.955	multicellular organismal process
GO:0009987	0.947	cellular process
GO:0048518	0.933	positive regulation of biological process
GO:0032502	0.885	developmental process
GO:0048856	0.884	anatomical structure development
GO:0007275	0.854	multicellular organism development
GO:0048522	0.840	positive regulation of cellular process
GO:0050896	0.800	response to stimulus
GO:0048731	0.746	system development
GO:0048523	0.736	negative regulation of cellular process
GO:0051240	0.546	positive regulation of multicellular organismal process
GO:0051094	0.512	positive regulation of developmental process
GO:0019222	0.507	regulation of metabolic process
GO:0060255	0.461	regulation of macromolecule metabolic process
GO:0051716	0.427	cellular response to stimulus
GO:0048583	0.409	regulation of response to stimulus
GO:0051171	0.361	regulation of nitrogen compound metabolic process
GO:0080090	0.341	regulation of primary metabolic process
GO:0010468	0.324	regulation of gene expression
GO:0009892	0.317	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	1.000	extracellular space
GO:0043227	0.976	membrane-bounded organelle
GO:0005737	0.976	cytoplasm
GO:0071944	0.969	cell periphery
GO:0012505	0.938	endomembrane system
GO:0031982	0.879	vesicle
GO:0043230	0.875	extracellular organelle
GO:0065010	0.868	extracellular membrane-bounded organelle
GO:0062023	0.847	collagen-containing extracellular matrix
GO:1903561	0.838	extracellular vesicle
GO:0043231	0.831	intracellular membrane-bounded organelle
GO:0070062	0.808	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]