StarFunc result for job id P36956

User Input

>input (1147 residues)
MDEPPFSEAALEQALGEPCDLDAALLTDIEDMLQLINNQDSDFPGLFDPPYAGSGAGGTD
PASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGP
GIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGN
TQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLL
QPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDA
EKLPINRLAAGSKAPASAQSRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKS
AVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKSKSLKDLVSACGSGGNTDVLMEGVKTE
VEDTLTPPPSDAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSR
GMLDRSRLALCTLVFLCLSCNPLASLLGARGLPSPSDTTSVYHSPGRNVLGTESRDGPGW
AQWLLPPVVWLLNGLLVLVSLVLLFVYGEPVTRPHSGPAVYFWRHRKQADLDLARGDFAQ
AAQQLWLALRALGRPLPTSHLDLACSLLWNLIRHLLQRLWVGRWLAGRAGGLQQDCALRV
DASASARDAALVYHKLHQLHTMGKHTGGHLTATNLALSALNLAECAGDAVSVATLAEIYV
AAALRVKTSLPRALHFLTRFFLSSARQACLAQSGSVPPAMQWLCHPVGHRFFVDGDWSVL
STPWESLYSLAGNPVDPLAQVTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYL
QLLNSCSDAAGAPAYSFSISSSMATTTGVDPVAKWWASLTAVVIHWLRRDEEAAERLCPL
VEHLPRVLQESERPLPRAALHSFKAARALLGCAKAESGPASLTICEKASGYLQDSLATTP
ASSSIDKAVQLFLCDLLLVVRTSLWRQQQPPAPAPAAQGTSSRPQASALELRGFQRDLSS
LRRLAQSFRPAMRRVFLHEATARLMAGASPTRTHQLLDRSLRRRAGPGGKGGAVAELEPR
PTRREHAEALLLASCYLPPGFLSAPGQRVGMLAEAARTLEKLGDRRLLHDCQQMLMRLGG
GTTVTSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P36956	1.000	1.000	0.000	1147	1.000	1.000	P36956.pdb.gz	SRBP1_HUMAN Sterol regulatory element-binding protein 1 OS=Homo sapiens OX=9606 GN=SREBF1 PE=1 SV=2
2	AFDB:P56720	0.645	0.652	1.651E-100	1134	0.806	0.815	P56720.pdb.gz	SRBP1_RAT Sterol regulatory element-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Srebf1 PE=1 SV=3
3	AFDB:R4GLV5	0.536	0.550	9.817E-79	1116	0.628	0.645	R4GLV5.pdb.gz
4	AFDB:A6XLD8	0.586	0.606	3.699E-69	1105	0.572	0.594	A6XLD8.pdb.gz	A6XLD8_DANRE Sterol regulatory element binding transcription factor 1 OS=Danio rerio OX=7955 GN=SREBF1 PE=2 SV=1
5	AFDB:A0A087X1T2	0.087	0.141	9.082E-16	654	0.212	0.372	A0A087X1T2.pdb.gz	A0A087X1T2_HUMAN Sterol regulatory element binding transcription factor 2 OS=Homo sapiens OX=9606 GN=SREBF2 PE=1 SV=1
6	AFDB:A0A0R4IZ84	0.099	0.078	4.428E-5	1544	0.124	0.092	A0A0R4IZ84.pdb.gz	EST1A_DANRE Telomerase-binding protein EST1A OS=Danio rerio OX=7955 GN=smg6 PE=2 SV=1
7	AFDB:Q9UQB3	0.098	0.095	6.489E-5	1225	0.147	0.138	Q9UQB3.pdb.gz	CTND2_HUMAN Catenin delta-2 OS=Homo sapiens OX=9606 GN=CTNND2 PE=1 SV=3
8	AFDB:O35927	0.110	0.104	8.809E-5	1247	0.139	0.128	O35927.pdb.gz	CTND2_MOUSE Catenin delta-2 OS=Mus musculus OX=10090 GN=Ctnnd2 PE=1 SV=1
9	AFDB:Q99569	0.114	0.112	1.066E-4	1192	0.129	0.124	Q99569.pdb.gz	PKP4_HUMAN Plakophilin-4 OS=Homo sapiens OX=9606 GN=PKP4 PE=1 SV=2
10	PDB:7dhgC	0.145	0.283	3.775E-4	470	0.043	0.104	7dhgC.pdb.gz
11	AFDB:M9PGK7	0.061	0.042	5.953E-4	2272	0.141	0.071	M9PGK7.pdb.gz	M9PGK7_DROME Klarsicht, isoform E OS=Drosophila melanogaster OX=7227 GN=klar PE=1 SV=1
12	PDB:6zp4C	0.151	0.223	6.891E-3	633	0.058	0.104	6zp4C.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
13	PDB:6c95A	0.115	0.147	7.728E-3	773	0.067	0.100	6c95A.pdb.gz	Structure of Human NatA and Its Regulation by the Huntingtin Interacting Protein HYPK.
14	PDB:6yj6A	0.107	0.139	1.132E-2	819	0.057	0.079	6yj6A.pdb.gz
15	PDB:5w94A	0.128	0.187	1.177E-2	617	0.067	0.125	5w94A.pdb.gz	The Kinetochore Receptor for the Cohesin Loading Complex.
16	PDB:4hnxA	0.090	0.130	1.724E-2	713	0.051	0.081	4hnxA.pdb.gz	The Protein Complex NatA Binds Inositol Hexakisphosphate and Exhibits Conformational Flexibility
17	PDB:7qe7Y	0.126	0.232	1.791E-2	502	0.052	0.120	7qe7Y.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
18	PDB:7sqcR1	0.113	0.079	1.791E-2	2080	0.085	0.047	7sqcR1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
19	PDB:8a3tJ	0.122	0.204	1.791E-2	509	0.046	0.104	8a3tJ.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
20	PDB:2y4uA	0.111	0.208	2.168E-2	424	0.051	0.139	2y4uA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A3KNA7	0.0	567	1099	0.383	0.399	SRBP2_DANRE Sterol regulatory element-binding protein 2 OS=Danio rerio OX=7955 GN=srebf2 PE=1 SV=1
2	A6XLD8	0.0	1093	1105	0.576	0.598	A6XLD8_DANRE Sterol regulatory element binding transcription factor 1 OS=Danio rerio OX=7955 GN=SREBF1 PE=2 SV=1
3	P36956	0.0	2289	1147	1.000	1.000	SRBP1_HUMAN Sterol regulatory element-binding protein 1 OS=Homo sapiens OX=9606 GN=SREBF1 PE=1 SV=2
4	P56720	0.0	1654	1134	0.805	0.814	SRBP1_RAT Sterol regulatory element-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Srebf1 PE=1 SV=3
5	Q12772	0.0	768	1141	0.392	0.394	SRBP2_HUMAN Sterol regulatory element-binding protein 2 OS=Homo sapiens OX=9606 GN=SREBF2 PE=1 SV=2
6	Q3T1I5	0.0	756	1133	0.402	0.407	SRBP2_RAT Sterol regulatory element-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Srebf2 PE=2 SV=1
7	Q3U1N2	0.0	775	1130	0.452	0.458	SRBP2_MOUSE Sterol regulatory element-binding protein 2 OS=Mus musculus OX=10090 GN=Srebf2 PE=1 SV=2
8	Q60429	0.0	752	1139	0.389	0.392	SRBP2_CRIGR Sterol regulatory element-binding protein 2 OS=Cricetulus griseus OX=10029 GN=SREBF2 PE=2 SV=1
9	Q90ZM5	0.0	1189	1115	0.627	0.645	Q90ZM5_CHICK Sterol regulatory element binding protein 1 OS=Gallus gallus OX=9031 PE=2 SV=1
10	Q9WTN3	0.0	1632	1134	0.802	0.811	SRBP1_MOUSE Sterol regulatory element-binding protein 1 OS=Mus musculus OX=10090 GN=Srebf1 PE=1 SV=4
11	Q9VW37	5.93e-124	410	1113	0.265	0.273	Q9VW37_DROME LP12374p OS=Drosophila melanogaster OX=7227 GN=SREBP PE=1 SV=1
12	Q24146	9.89e-124	410	1113	0.264	0.272	Q24146_DROME HLH106 OS=Drosophila melanogaster OX=7227 GN=SREBP PE=2 SV=1
13	A0A087X1T2	1.13e-90	307	654	0.158	0.277	A0A087X1T2_HUMAN Sterol regulatory element binding transcription factor 2 OS=Homo sapiens OX=9606 GN=SREBF2 PE=1 SV=1
14	Q98SH5	5.55e-79	267	396	0.161	0.467	Q98SH5_CHICK Sterol regulatory element binding protein 2 (Fragment) OS=Gallus gallus OX=9031 GN=SREBP2 PE=2 SV=1
15	Q90WR7	1.31e-77	267	521	0.161	0.355	Q90WR7_CHICK Sterol regulatory element binding protein 2 (Fragment) OS=Gallus gallus OX=9031 GN=SREBP-2 PE=2 SV=1
16	Q9XX00	9.00e-41	166	1113	0.168	0.173	SRBPH_CAEEL Sterol regulatory element binding protein sbp-1 OS=Caenorhabditis elegans OX=6239 GN=sbp-1 PE=2 SV=1
17	O43019	6.58e-11	69.3	793	0.033	0.048	SRE2_SCHPO Putative transcription factor sre2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sre2 PE=1 SV=1
18	Q4WIN1	1.13e-10	68.6	988	0.032	0.037	Q4WIN1_ASPFU HLH transcription factor, putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_2G01260 PE=4 SV=1
19	Q9UUD1	1.18e-09	65.1	900	0.033	0.042	SREBP_SCHPO Sterol regulatory element-binding protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sre1 PE=1 SV=1
20	Q59RL7	1.27e-08	61.6	853	0.031	0.042	CPH2_CANAL Transcription factor CPH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CPH2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16559 GIT_CC	7.6e+02	11.3	GIT coiled-coil Rho guanine nucleotide exchange factor
2	PF00010 HLH	6.8e-14	62.9	Helix-loop-helix DNA-binding domain
3	PF15898 PRKG1_interact	7.8e+02	12.2	cGMP-dependent protein kinase interacting domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000348069

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265565	0.999	Sterol regulatory element-binding protein cleavage-activating protein
2	9606.ENSP00000304592	0.993	Fatty acid synthase
3	9606.ENSP00000359380	0.990	Acyl-CoA desaturase
4	9606.ENSP00000287936	0.988	3-hydroxy-3-methylglutaryl-coenzyme A reductase
5	9606.ENSP00000357283	0.988	Prelamin-A/C
6	9606.ENSP00000483300	0.988	Acetyl-CoA carboxylase 1
7	9606.ENSP00000263205	0.987	Mediator of RNA polymerase II transcription subunit 15
8	9606.ENSP00000287820	0.986	Peroxisome proliferator-activated receptor gamma
9	9606.ENSP00000477707	0.984	Oxysterols receptor LXR-alpha
10	9606.ENSP00000263253	0.982	Histone acetyltransferase p300
11	9606.ENSP00000253727	0.978	Oxysterols receptor LXR-beta
12	9606.ENSP00000368798	0.973	Membrane-bound transcription factor site-2 protease
13	9606.ENSP00000322706	0.971	Hydroxymethylglutaryl-CoA synthase, cytoplasmic
14	9606.ENSP00000341044	0.971	Acetyl-CoA carboxylase 2
15	9606.ENSP00000265276	0.970	Glycerol-3-phosphate acyltransferase 1, mitochondrial
16	9606.ENSP00000378105	0.970	Elongation of very long chain fatty acids protein 6
17	9606.ENSP00000454071	0.970	Low-density lipoprotein receptor
18	9606.ENSP00000368880	0.969	Forkhead box protein O1
19	9606.ENSP00000344223	0.960	Membrane-bound transcription factor site-1 protease
20	9606.ENSP00000354558	0.960	Serine/threonine-protein kinase mTOR

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.998	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0008134	0.869	transcription factor binding
GO:0098531	0.757	ligand-activated transcription factor activity
GO:0004879	0.735	nuclear receptor activity
GO:0001221	0.730	transcription coregulator binding
GO:0032810	0.359	sterol response element binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.992	organic substance metabolic process
GO:0009987	0.991	cellular process
GO:0044238	0.991	primary metabolic process
GO:0051252	0.977	regulation of RNA metabolic process
GO:0045935	0.976	positive regulation of nucleobase-containing compound metabolic process
GO:0050896	0.964	response to stimulus
GO:0031326	0.962	regulation of cellular biosynthetic process
GO:0010604	0.959	positive regulation of macromolecule metabolic process
GO:0031328	0.954	positive regulation of cellular biosynthetic process
GO:0044237	0.946	cellular metabolic process
GO:0051254	0.946	positive regulation of RNA metabolic process
GO:2001141	0.927	regulation of RNA biosynthetic process
GO:0051716	0.912	cellular response to stimulus
GO:0009058	0.899	biosynthetic process
GO:0006355	0.885	regulation of DNA-templated transcription
GO:1901360	0.884	organic cyclic compound metabolic process
GO:1901576	0.873	organic substance biosynthetic process
GO:0007154	0.868	cell communication
GO:0010557	0.858	positive regulation of macromolecule biosynthetic process
GO:0045893	0.853	positive regulation of DNA-templated transcription
GO:0006807	0.832	nitrogen compound metabolic process
GO:0006357	0.823	regulation of transcription by RNA polymerase II
GO:0043170	0.768	macromolecule metabolic process
GO:0006629	0.760	lipid metabolic process
GO:0046483	0.759	heterocycle metabolic process
GO:0032879	0.741	regulation of localization
GO:0044249	0.740	cellular biosynthetic process
GO:0034641	0.703	cellular nitrogen compound metabolic process
GO:0006725	0.675	cellular aromatic compound metabolic process
GO:0007165	0.653	signal transduction
GO:0019216	0.619	regulation of lipid metabolic process
GO:0019438	0.600	aromatic compound biosynthetic process
GO:0006950	0.571	response to stress
GO:0009314	0.547	response to radiation
GO:0045834	0.525	positive regulation of lipid metabolic process
GO:0009059	0.491	macromolecule biosynthetic process
GO:0006139	0.484	nucleobase-containing compound metabolic process
GO:0019218	0.450	regulation of steroid metabolic process
GO:0046890	0.417	regulation of lipid biosynthetic process
GO:0048519	0.409	negative regulation of biological process
GO:0090304	0.407	nucleic acid metabolic process
GO:0045944	0.407	positive regulation of transcription by RNA polymerase II
GO:0048523	0.396	negative regulation of cellular process
GO:0008610	0.387	lipid biosynthetic process
GO:0046889	0.387	positive regulation of lipid biosynthetic process
GO:0042221	0.330	response to chemical
GO:1901362	0.327	organic cyclic compound biosynthetic process
GO:0009894	0.326	regulation of catabolic process
GO:0045940	0.318	positive regulation of steroid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0016020	0.999	membrane
GO:0012505	0.999	endomembrane system
GO:0005737	0.999	cytoplasm
GO:0070013	0.995	intracellular organelle lumen
GO:0005654	0.993	nucleoplasm
GO:0031090	0.965	organelle membrane
GO:0005783	0.961	endoplasmic reticulum
GO:0005789	0.939	endoplasmic reticulum membrane
GO:0005829	0.878	cytosol
GO:0005794	0.694	Golgi apparatus
GO:0098588	0.652	bounding membrane of organelle
GO:0000139	0.363	Golgi membrane
GO:0031975	0.344	envelope
GO:0032991	0.316	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]