StarFunc result for job id P36957

User Input

>input (453 residues)
MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPNSRKVVINNSVFSVRFF
RTTAVCKDDLVTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPAN
GVIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPAAAAPKAEPTAAAVPPPAAPI
PTQMPPVPSPSQPPSGKPVSAVKPTVAPPLAEPGAGKGLRSEHREKMNRMRQRIAQRLKE
AQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNA
VIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELA
IEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGKVEVRPMMYVAL
TYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9N0F1	0.837	0.833	4.591E-83	455	0.938	0.934	Q9N0F1.pdb.gz	ODO2_PIG Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Sus scrofa OX=9823 GN=DLST PE=1 SV=1
2	AFDB:F1QFQ6	0.766	0.757	1.616E-72	458	0.740	0.731	F1QFQ6.pdb.gz
3	AFDB:Q9VGQ1	0.737	0.713	4.822E-58	468	0.543	0.526	Q9VGQ1.pdb.gz	Q9VGQ1_DROME Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Drosophila melanogaster OX=7227 GN=alpha-KGDHC PE=1 SV=1
4	AFDB:Q383B2	0.496	0.585	2.710E-51	383	0.444	0.525	Q383B2.pdb.gz	Q383B2_TRYB2 Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.3550 PE=3 SV=1
5	AFDB:O94681	0.678	0.679	9.696E-51	452	0.430	0.431	O94681.pdb.gz	ODO2_SCHPO Probable dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=kgd2 PE=3 SV=1
6	AFDB:Q5BKV3	0.494	0.455	9.534E-41	493	0.269	0.247	Q5BKV3.pdb.gz	Q5BKV3_DANRE Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex OS=Danio rerio OX=7955 GN=zgc:103768 PE=1 SV=1
7	AFDB:Q23571	0.616	0.622	5.892E-40	448	0.241	0.243	Q23571.pdb.gz	ODB2_CAEEL Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=dbt-1 PE=2 SV=1
8	AFDB:O00330	0.523	0.476	6.682E-39	501	0.269	0.244	O00330.pdb.gz	ODPX_HUMAN Pyruvate dehydrogenase protein X component, mitochondrial OS=Homo sapiens OX=9606 GN=PDHX PE=1 SV=3
9	AFDB:P75392	0.511	0.573	3.442E-38	402	0.252	0.284	P75392.pdb.gz	ODP2_MYCPN Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) OX=272634 GN=pdhC PE=1 SV=1
10	AFDB:Q57Z16	0.534	0.549	6.711E-38	439	0.223	0.230	Q57Z16.pdb.gz	Q57Z16_TRYB2 Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.45E22.630 PE=3 SV=1
11	PDB:7b9kA	0.514	0.719	3.995E-33	320	0.219	0.309	7b9kA.pdb.gz
12	PDB:6h60A	0.461	0.875	6.412E-22	233	0.159	0.309	6h60A.pdb.gz
13	PDB:6h55A	0.481	0.915	9.230E-22	233	0.157	0.305	6h55A.pdb.gz
14	PDB:6lpwB	0.245	0.253	3.765E-5	436	0.086	0.089	6lpwB.pdb.gz	Structural and Biochemical Insights Into Two BAHD Acyltransferases ( At SHT and At SDT) Involved in Phenolamide Biosynthesis.
15	PDB:5ja2A	0.232	0.100	6.502E-5	1238	0.060	0.022	5ja2A.pdb.gz	Structures of a Nonribosomal Peptide Synthetase Module Bound to MbtH-like Proteins Support a Highly Dynamic Domain Architecture.
16	PDB:3bg5B	0.136	0.059	8.808E-5	1074	0.042	0.018	3bg5B.pdb.gz	Crystal structures of human and Staphylococcus aureus pyruvate carboxylase and molecular insights into the carboxyltransfer reaction.
17	PDB:1xl8B	0.255	0.201	1.193E-4	600	0.068	0.052	1xl8B.pdb.gz	Crystal structure of mouse carnitine octanoyltransferase and molecular determinants of substrate selectivity.
18	PDB:4hnvB	0.135	0.061	1.193E-4	1033	0.044	0.019	4hnvB.pdb.gz	Characterizing the Importance of the Biotin Carboxylase Domain Dimer for Staphylococcus aureus Pyruvate Carboxylase Catalysis.
19	PDB:4eywB	0.249	0.186	1.432E-4	634	0.075	0.054	4eywB.pdb.gz	Isothermal titration calorimetry with micelles: Thermodynamics of inhibitor binding to carnitine palmitoyltransferase 2 membrane protein.
20	PDB:1q6xA	0.233	0.184	1.616E-4	600	0.073	0.055	1q6xA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P36957	0.0	921	453	1.000	1.000	ODO2_HUMAN Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Homo sapiens OX=9606 GN=DLST PE=1 SV=4
2	Q01205	0.0	782	454	0.929	0.927	ODO2_RAT Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Rattus norvegicus OX=10116 GN=Dlst PE=1 SV=2
3	Q7ZVL3	0.0	616	458	0.713	0.705	Q7ZVL3_DANRE Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Danio rerio OX=7955 GN=wu:fc39d01 PE=1 SV=1
4	Q9D2G2	0.0	774	454	0.914	0.912	ODO2_MOUSE Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Mus musculus OX=10090 GN=Dlst PE=1 SV=1
5	Q9N0F1	0.0	788	455	0.936	0.932	ODO2_PIG Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Sus scrofa OX=9823 GN=DLST PE=1 SV=1
6	Q86SW4	1.17e-176	497	279	0.545	0.885	Q86SW4_HUMAN Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (Fragment) OS=Homo sapiens OX=9606 GN=DLST PE=1 SV=1
7	Q9FLQ4	4.68e-123	368	464	0.442	0.431	ODO2A_ARATH Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g55070 PE=1 SV=1
8	Q9VGQ1	8.24e-122	365	468	0.375	0.363	Q9VGQ1_DROME Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Drosophila melanogaster OX=7227 GN=alpha-KGDHC PE=1 SV=1
9	Q8H107	9.79e-121	362	464	0.433	0.422	ODO2B_ARATH Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g26910 PE=1 SV=2
10	P19262	3.10e-117	353	463	0.433	0.423	ODO2_YEAST Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KGD2 PE=1 SV=2
11	Q383B2	9.60e-115	343	383	0.424	0.501	Q383B2_TRYB2 Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.3550 PE=3 SV=1
12	P0AFG6	8.25e-109	329	405	0.411	0.459	ODO2_ECOLI Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Escherichia coli (strain K12) OX=83333 GN=sucB PE=1 SV=2
13	O94681	1.08e-108	330	452	0.428	0.429	ODO2_SCHPO Probable dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=kgd2 PE=3 SV=1
14	Q8IEA6	2.72e-102	313	421	0.371	0.399	Q8IEA6_PLAF7 dihydrolipoyllysine-residue succinyltransferase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1320800 PE=3 SV=1
15	Q19749	4.06e-47	171	507	0.309	0.276	ODP2_CAEEL Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=dlat-1 PE=1 SV=1
16	Q9HIA5	6.32e-46	166	400	0.269	0.305	Q9HIA5_THEAC Probable lipoamide acyltransferase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) OX=273075 GN=Ta1436 PE=1 SV=1
17	Q5AYC2	6.18e-42	157	488	0.280	0.260	Q5AYC2_EMENI Acetyltransferase component of pyruvate dehydrogenase complex OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06708 PE=3 SV=1
18	P9WIS7	1.07e-40	154	553	0.199	0.163	ODP2_MYCTU Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=dlaT PE=1 SV=1
19	O59816	1.21e-38	148	483	0.313	0.294	ODP2_SCHPO Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lat1 PE=3 SV=1
20	P53395	2.85e-37	144	482	0.258	0.243	ODB2_MOUSE Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Mus musculus OX=10090 GN=Dbt PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00198 2-oxoacid_dh	3.5e-77	270.6	2-oxoacid dehydrogenases acyltransferase (catalytic domain)
2	PF00364 Biotin_lipoyl	7.4e-19	78.7	Biotin-requiring enzyme
3	PF13533 Biotin_lipoyl_2	8.1	17.6	Biotin-lipoyl like
4	PF13388 DUF4106	90	13.8	Protein of unknown function (DUF4106)
5	PF01597 GCV_H	5.8e+02	11.8	Glycine cleavage H-protein
6	PF05300 MIC19_MIC25	5e+02	12.2	MICOS complex subunit MIC19/MIC25

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000335304

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000205402	0.999	Dihydrolipoyl dehydrogenase, mitochondrial
2	9606.ENSP00000222673	0.999	2-oxoglutarate dehydrogenase, mitochondrial
3	9606.ENSP00000363216	0.999	2-oxoglutarate dehydrogenase-like, mitochondrial
4	9606.ENSP00000377446	0.997	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
5	9606.ENSP00000367923	0.995	Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial
6	9606.ENSP00000263035	0.989	Probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial
7	9606.ENSP00000280346	0.988	Dihydrolipoamide S-acetyltransferase
8	9606.ENSP00000215375	0.985	ATP synthase subunit delta, mitochondrial
9	9606.ENSP00000319531	0.983	Glycine cleavage system H protein, mitochondrial
10	9606.ENSP00000364649	0.978	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
11	9606.ENSP00000377115	0.959	Lipoyltransferase 1, mitochondrial
12	9606.ENSP00000419325	0.952	Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial
13	9606.ENSP00000264932	0.951	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
14	9606.ENSP00000227868	0.944	Pyruvate dehydrogenase protein X component, mitochondrial
15	9606.ENSP00000307241	0.942	Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
16	9606.ENSP00000216254	0.938	Aconitate hydratase, mitochondrial
17	9606.ENSP00000318351	0.938	2-oxoisovalerate dehydrogenase subunit beta, mitochondrial
18	9606.ENSP00000222214	0.934	Glutaryl-CoA dehydrogenase, mitochondrial
19	9606.ENSP00000306397	0.927	Cytochrome b-c1 complex subunit Rieske, mitochondrial
20	9606.ENSP00000317159	0.925	Cytochrome c1, heme protein, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140096	1.000	catalytic activity, acting on a protein
GO:0005515	1.000	protein binding
GO:0016417	1.000	S-acyltransferase activity
GO:0016748	0.741	succinyltransferase activity
GO:0004149	0.575	dihydrolipoyllysine-residue succinyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.994	organic substance metabolic process
GO:0044238	0.994	primary metabolic process
GO:0044237	0.993	cellular metabolic process
GO:0044281	0.969	small molecule metabolic process
GO:0006807	0.957	nitrogen compound metabolic process
GO:0045333	0.946	cellular respiration
GO:1901564	0.943	organonitrogen compound metabolic process
GO:0009060	0.893	aerobic respiration
GO:0006163	0.882	purine nucleotide metabolic process
GO:0006099	0.843	tricarboxylic acid cycle
GO:0043648	0.724	dicarboxylic acid metabolic process
GO:1901135	0.637	carbohydrate derivative metabolic process
GO:0019693	0.424	ribose phosphate metabolic process
GO:0009259	0.399	ribonucleotide metabolic process
GO:0009150	0.393	purine ribonucleotide metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.996	mitochondrion
GO:0070013	0.995	intracellular organelle lumen
GO:0016020	0.994	membrane
GO:0005634	0.988	nucleus
GO:1902494	0.987	catalytic complex
GO:0005829	0.977	cytosol
GO:1990204	0.964	oxidoreductase complex
GO:0005759	0.929	mitochondrial matrix
GO:0045239	0.913	tricarboxylic acid cycle enzyme complex
GO:1990234	0.865	transferase complex
GO:0045252	0.856	oxoglutarate dehydrogenase complex
GO:0031981	0.833	nuclear lumen
GO:0005654	0.792	nucleoplasm
GO:0071944	0.545	cell periphery
GO:0098798	0.461	mitochondrial protein-containing complex
GO:0005886	0.409	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	1.000	Transferring groups other than amino-acyl groups.
RHEA:15213	0.575	(R)-N(6)-dihydrolipoyl-L-lysyl-[2-oxoglutarate dehydrogenase complex component E2] + succinyl-CoA = (R)-N(6)-(S(8)-succinyldihydrolipoyl)-L-lysyl-[2-oxoglutarate dehydrogenase complex component E2] + CoA
EC:2.3.1.61	0.575	dihydrolipoyllysine-residue succinyltransferase.

[back to server]