StarFunc result for job id P36959

User Input

>input (345 residues)
MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGT
FEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAV
PQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGV
GPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVM
LGGMFSGHTECAGEVFERNGRKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYKGD
VENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P36959	1.000	1.000	7.173E-76	345	1.000	1.000	P36959.pdb.gz	GMPR1_HUMAN GMP reductase 1 OS=Homo sapiens OX=9606 GN=GMPR PE=1 SV=1
2	AFDB:Q99L27	0.995	0.986	1.694E-67	348	0.786	0.779	Q99L27.pdb.gz	GMPR2_MOUSE GMP reductase 2 OS=Mus musculus OX=10090 GN=Gmpr2 PE=1 SV=2
3	PDB:2bleA	0.956	0.979	5.493E-65	337	0.974	0.997	2bleA.pdb.gz	Structure of Human Guanosine Monophosphate Reductase Gmpr1 in Complex with Gmp
4	AFDB:P60560	0.987	0.982	6.237E-61	347	0.661	0.657	P60560.pdb.gz	GUAC_ECOLI GMP reductase OS=Escherichia coli (strain K12) OX=83333 GN=guaC PE=1 SV=1
5	PDB:2a7rA	0.955	0.975	1.019E-59	338	0.786	0.802	2a7rA.pdb.gz	Crystal Structure of Human Guanosine Monophosphate Reductase 2 (GMPR2) in Complex with GMP
6	PDB:2a7rD	0.909	0.989	2.778E-56	317	0.733	0.798	2a7rD.pdb.gz	Crystal Structure of Human Guanosine Monophosphate Reductase 2 (GMPR2) in Complex with GMP
7	AFDB:Q57ZS7	0.839	0.595	3.926E-34	491	0.345	0.242	Q57ZS7.pdb.gz	Q57ZS7_TRYB2 Inosine-5'-monophosphate dehydrogenase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.1P6.110 PE=1 SV=1
8	AFDB:Q72D85	0.880	0.633	2.716E-33	485	0.336	0.239	Q72D85.pdb.gz	Q72D85_DESVH Inosine-5'-monophosphate dehydrogenase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=guaB PE=1 SV=1
9	PDB:6jigA	0.843	0.611	1.545E-32	480	0.342	0.246	6jigA.pdb.gz	Allosteric regulation accompanied by oligomeric state changes of Trypanosoma brucei GMP reductase through cystathionine-beta-synthase domain.
10	AFDB:Q9HXM5	0.872	0.622	3.374E-32	489	0.357	0.252	Q9HXM5.pdb.gz	Q9HXM5_PSEAE Inosine-5'-monophosphate dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=guaB PE=1 SV=1
11	AFDB:P0ADG7	0.859	0.613	4.023E-32	488	0.348	0.246	P0ADG7.pdb.gz	IMDH_ECOLI Inosine-5'-monophosphate dehydrogenase OS=Escherichia coli (strain K12) OX=83333 GN=guaB PE=1 SV=1
12	PDB:7rerA	0.854	0.760	6.571E-31	389	0.290	0.257	7rerA.pdb.gz	IMPDH1 retinal variants control filament architecture to tune allosteric regulation.
13	AFDB:P9WKI3	0.855	0.622	2.164E-30	479	0.354	0.255	P9WKI3.pdb.gz	GUAB1_MYCTU GMP reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=guaB1 PE=1 SV=1
14	PDB:7rglA	0.831	0.692	4.544E-30	416	0.278	0.231	7rglA.pdb.gz	IMPDH1 retinal variants control filament architecture to tune allosteric regulation.
15	AFDB:P9WKI7	0.862	0.570	6.985E-30	529	0.310	0.202	P9WKI7.pdb.gz	IMDH_MYCTU Inosine-5'-monophosphate dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=guaB PE=1 SV=1
16	PDB:6gk9G	0.794	0.832	1.161E-29	329	0.328	0.343	6gk9G.pdb.gz	First-in-class allosteric inhibitors of bacterial IMPDHs.
17	AFDB:A0A384N6C2	0.844	0.574	2.127E-29	514	0.275	0.185	A0A384N6C2.pdb.gz	A0A384N6C2_HUMAN Inosine-5'-monophosphate dehydrogenase OS=Homo sapiens OX=9606 GN=IMPDH PE=2 SV=1
18	PDB:1me7A	0.864	0.819	2.964E-29	365	0.261	0.247	1me7A.pdb.gz	Crystal Structure of Tritrichomonas foetus Inosine Monophosphate Dehydrogenase in Complex with the Inhibitor Ribavirin Monophosphate Reveals a Catalysis-dependent Ion-binding Site
19	PDB:6jl8A	0.751	0.577	8.511E-29	453	0.333	0.254	6jl8A.pdb.gz
20	PDB:1nf7A	0.825	0.633	2.305E-28	454	0.272	0.207	1nf7A.pdb.gz	Crystal Structure of Human Inosine Monophosphate Dehydrogenase type II complexed with the MPA/NAD analog C2-MAD

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P36959	0.0	716	345	1.000	1.000	GMPR1_HUMAN GMP reductase 1 OS=Homo sapiens OX=9606 GN=GMPR PE=1 SV=1
2	Q99L27	0.0	584	348	0.788	0.782	GMPR2_MOUSE GMP reductase 2 OS=Mus musculus OX=10090 GN=Gmpr2 PE=1 SV=2
3	Q9P2T1	0.0	590	348	0.797	0.790	GMPR2_HUMAN GMP reductase 2 OS=Homo sapiens OX=9606 GN=GMPR2 PE=1 SV=1
4	Q9Z244	0.0	688	345	0.957	0.957	GMPR1_RAT GMP reductase 1 OS=Rattus norvegicus OX=10116 GN=Gmpr PE=2 SV=1
5	P60560	2.15e-175	492	347	0.661	0.657	GUAC_ECOLI GMP reductase OS=Escherichia coli (strain K12) OX=83333 GN=guaC PE=1 SV=1
6	Q72D85	1.11e-45	164	485	0.255	0.181	Q72D85_DESVH Inosine-5'-monophosphate dehydrogenase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=guaB PE=1 SV=1
7	P9WKI3	4.97e-43	157	479	0.267	0.192	GUAB1_MYCTU GMP reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=guaB1 PE=1 SV=1
8	Q57ZS7	1.13e-41	153	491	0.270	0.189	Q57ZS7_TRYB2 Inosine-5'-monophosphate dehydrogenase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.1P6.110 PE=1 SV=1
9	Q9HXM5	1.03e-37	142	489	0.243	0.172	Q9HXM5_PSEAE Inosine-5'-monophosphate dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=guaB PE=1 SV=1
10	P0ADG7	1.81e-34	134	488	0.243	0.172	IMDH_ECOLI Inosine-5'-monophosphate dehydrogenase OS=Escherichia coli (strain K12) OX=83333 GN=guaB PE=1 SV=1
11	B0UXP9	4.65e-32	127	514	0.226	0.152	IMDH2_DANRE Inosine-5'-monophosphate dehydrogenase 2 OS=Danio rerio OX=7955 GN=impdh2 PE=3 SV=1
12	P24547	1.28e-31	126	514	0.217	0.146	IMDH2_MOUSE Inosine-5'-monophosphate dehydrogenase 2 OS=Mus musculus OX=10090 GN=Impdh2 PE=1 SV=2
13	E9PU28	2.76e-31	125	514	0.209	0.140	IMDH2_RAT Inosine-5'-monophosphate dehydrogenase 2 OS=Rattus norvegicus OX=10116 GN=Impdh2 PE=1 SV=1
14	E7ETK5	4.81e-31	124	489	0.217	0.153	E7ETK5_HUMAN Inosine-5'-monophosphate dehydrogenase OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2
15	A0A384N6C2	8.52e-31	124	514	0.217	0.146	A0A384N6C2_HUMAN Inosine-5'-monophosphate dehydrogenase OS=Homo sapiens OX=9606 GN=IMPDH PE=2 SV=1
16	P12268	8.52e-31	124	514	0.217	0.146	IMDH2_HUMAN Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2
17	P9WKI7	8.75e-31	124	529	0.229	0.149	IMDH_MYCTU Inosine-5'-monophosphate dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=guaB PE=1 SV=1
18	Q6FM59	2.54e-30	122	527	0.229	0.150	Q6FM59_CANGA Inosine-5'-monophosphate dehydrogenase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0K10780g PE=3 SV=1
19	P50094	1.11e-29	120	524	0.220	0.145	IMDH4_YEAST Inosine-5'-monophosphate dehydrogenase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IMD4 PE=1 SV=1
20	Q59Q46	3.59e-29	119	521	0.220	0.146	IMDH_CANAL Inosine-5'-monophosphate dehydrogenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=IMH3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01081 Aldolase	18	16.2	KDPG and KHG aldolase
2	PF01070 FMN_dh	0.18	22.4	FMN-dependent dehydrogenase
3	PF01645 Glu_synthase	1.9e+02	12.6	Conserved region in glutamate synthase
4	PF00478 IMPDH	2.8e-77	271.6	IMP dehydrogenase / GMP reductase domain
5	PF01729 QRPTase_C	1e+02	14.1	Quinolinate phosphoribosyl transferase, C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000259727

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000419851	0.993	GMP synthase [glutamine-hydrolyzing]
2	9606.ENSP00000355493	0.969	Adenylosuccinate synthetase isozyme 2
3	9606.ENSP00000379802	0.963	AMP deaminase 3
4	9606.ENSP00000367615	0.955	Adenine phosphoribosyltransferase
5	9606.ENSP00000256578	0.951	AMP deaminase 2
6	9606.ENSP00000333019	0.948	Adenylosuccinate synthetase isozyme 1
7	9606.ENSP00000236959	0.947	Bifunctional purine biosynthesis protein PURH
8	9606.ENSP00000430075	0.941	AMP deaminase 1
9	9606.ENSP00000298556	0.937	Hypoxanthine-guanine phosphoribosyltransferase
10	9606.ENSP00000369456	0.934	Inosine triphosphate pyrophosphatase
11	9606.ENSP00000257770	0.930	5'-nucleotidase
12	9606.ENSP00000484415	0.930	Cytosolic 5'-nucleotidase 3A
13	9606.ENSP00000321584	0.920	Inosine-5'-monophosphate dehydrogenase 2
14	9606.ENSP00000345096	0.919	Inosine-5'-monophosphate dehydrogenase 1
15	9606.ENSP00000355689	0.915	Guanylate kinase
16	9606.ENSP00000339479	0.912	Cytosolic purine 5'-nucleotidase
17	9606.ENSP00000354238	0.907	Ectonucleotide pyrophosphatase/phosphodiesterase family member 1
18	9606.ENSP00000235628	0.906	Cytosolic 5'-nucleotidase 1A
19	9606.ENSP00000389948	0.906	7-methylguanosine phosphate-specific 5'-nucleotidase
20	9606.ENSP00000352904	0.905	Cytosolic 5'-nucleotidase 1B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016661	0.999	oxidoreductase activity, acting on other nitrogenous compounds as donors
GO:0005515	0.995	protein binding
GO:0046857	0.890	oxidoreductase activity, acting on other nitrogenous compounds as donors, with NAD or NADP as acceptor
GO:0003920	0.766	GMP reductase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009628	0.987	response to abiotic stimulus
GO:0009987	0.955	cellular process
GO:0071704	0.932	organic substance metabolic process
GO:0009266	0.928	response to temperature stimulus
GO:0044238	0.923	primary metabolic process
GO:0044237	0.923	cellular metabolic process
GO:0009409	0.922	response to cold
GO:0006807	0.911	nitrogen compound metabolic process
GO:0034641	0.829	cellular nitrogen compound metabolic process
GO:0006725	0.827	cellular aromatic compound metabolic process
GO:1901360	0.826	organic cyclic compound metabolic process
GO:0006139	0.816	nucleobase-containing compound metabolic process
GO:0006163	0.761	purine nucleotide metabolic process
GO:0019693	0.744	ribose phosphate metabolic process
GO:0009259	0.730	ribonucleotide metabolic process
GO:0009150	0.708	purine ribonucleotide metabolic process
GO:0009123	0.447	nucleoside monophosphate metabolic process
GO:0009161	0.425	ribonucleoside monophosphate metabolic process
GO:0090407	0.365	organophosphate biosynthetic process
GO:0009167	0.353	purine ribonucleoside monophosphate metabolic process
GO:0034654	0.351	nucleobase-containing compound biosynthetic process
GO:1901293	0.304	nucleoside phosphate biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.7.-.-	0.999	Acting on other nitrogenous compounds as donors.
EC:1.7.1.-	0.890	With NAD(+) or NADP(+) as acceptor.
RHEA:17185	0.766	IMP + NADP(+) + NH4(+) = GMP + 2 H(+) + NADPH
EC:1.7.1.7	0.766	GMP reductase.

[back to server]