StarFunc result for job id P37023

User Input

>input (503 residues)
MTLGSPRKGLLMLLMALVTQGDPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEG
RHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQLA
LILGPVLALLALVALGVLGLWHVRRRQEKQRGLHSELGESSLILKASEQGDSMLGDLLDS
DCTTGSGSGLPFLVQRTVARQVALVECVGKGRYGEVWRGLWHGESVAVKIFSSRDEQSWF
RETEIYNTVLLRHDNILGFIASDMTSRNSSTQLWLITHYHEHGSLYDFLQRQTLEPHLAL
RLAVSAACGLAHLHVEIFGTQGKPAIAHRDFKSRNVLVKSNLQCCIADLGLAVMHSQGSD
YLDIGNNPRVGTKRYMAPEVLDEQIRTDCFESYKWTDIWAFGLVLWEIARRTIVNGIVED
YRPPFYDVVPNDPSFEDMKKVVCVDQQTPTIPNRLAADPVLSGLAQMMRECWYPNPSARL
TALRIKKTLQKISNSPEKPKVIQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P80203	0.637	0.635	2.049E-87	504	0.897	0.895	P80203.pdb.gz	ACVL1_RAT Serine/threonine-protein kinase receptor R3 OS=Rattus norvegicus OX=10116 GN=Acvrl1 PE=1 SV=2
2	AFDB:A4FUX2	0.608	0.608	4.399E-84	503	0.909	0.909	A4FUX2.pdb.gz	A4FUX2_BOVIN receptor protein serine/threonine kinase OS=Bos taurus OX=9913 GN=ACVRL1 PE=2 SV=1
3	AFDB:O73736	0.588	0.585	2.027E-65	506	0.602	0.599	O73736.pdb.gz	O73736_DANRE receptor protein serine/threonine kinase OS=Danio rerio OX=7955 GN=acvr1 PE=2 SV=1
4	AFDB:Q90ZK6	0.592	0.591	3.535E-65	504	0.588	0.587	Q90ZK6.pdb.gz	ACVR1_CHICK Activin receptor type-1 OS=Gallus gallus OX=9031 GN=ACVR1 PE=2 SV=1
5	AFDB:F1QH44	0.595	0.596	3.771E-63	502	0.575	0.576	F1QH44.pdb.gz
6	AFDB:P37172	0.593	0.586	2.639E-62	509	0.573	0.566	P37172.pdb.gz	ACVR1_MOUSE Activin receptor type-1 OS=Mus musculus OX=10090 GN=Acvr1 PE=1 SV=2
7	AFDB:A0A0B4K7J3	0.596	0.516	3.132E-55	582	0.495	0.428	A0A0B4K7J3.pdb.gz	A0A0B4K7J3_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=sax PE=3 SV=1
8	AFDB:F1P3H0	0.586	0.553	1.329E-54	533	0.463	0.437	F1P3H0.pdb.gz	F1P3H0_CHICK receptor protein serine/threonine kinase OS=Gallus gallus OX=9031 GN=BMPR1A PE=3 SV=1
9	AFDB:P70539	0.588	0.600	2.590E-54	493	0.445	0.454	P70539.pdb.gz	ACV1C_RAT Activin receptor type-1C OS=Rattus norvegicus OX=10116 GN=Acvr1c PE=1 SV=1
10	AFDB:B3DJ37	0.587	0.585	2.894E-54	505	0.451	0.450	B3DJ37.pdb.gz
11	PDB:1k9aB	0.413	0.468	2.608E-16	441	0.145	0.166	1k9aB.pdb.gz
12	PDB:8dksA	0.403	0.689	6.347E-16	283	0.135	0.240	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
13	PDB:6lk5A	0.411	0.746	2.040E-15	265	0.139	0.264	6lk5A.pdb.gz
14	PDB:4rerA	0.438	0.477	4.202E-15	459	0.135	0.148	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
15	PDB:4c0tA	0.445	0.734	7.746E-15	291	0.121	0.210	4c0tA.pdb.gz
16	PDB:1unlA	0.427	0.708	8.657E-15	292	0.133	0.229	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
17	PDB:2bujA	0.439	0.732	1.278E-14	291	0.131	0.227	2bujA.pdb.gz	Crystal Structure of the Human Serine-Threonine Kinase 16 in Complex with Staurosporine
18	PDB:4eomC	0.432	0.753	1.351E-14	276	0.129	0.236	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
19	PDB:4rewA	0.436	0.525	1.596E-14	411	0.141	0.173	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
20	PDB:2h8hA	0.423	0.473	1.687E-14	445	0.153	0.173	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A4FUX2	0.0	921	503	0.885	0.885	A4FUX2_BOVIN receptor protein serine/threonine kinase OS=Bos taurus OX=9913 GN=ACVRL1 PE=2 SV=1
2	O73736	0.0	575	506	0.598	0.595	O73736_DANRE receptor protein serine/threonine kinase OS=Danio rerio OX=7955 GN=acvr1 PE=2 SV=1
3	P37023	0.0	1041	503	1.000	1.000	ACVL1_HUMAN Serine/threonine-protein kinase receptor R3 OS=Homo sapiens OX=9606 GN=ACVRL1 PE=1 SV=2
4	P37172	0.0	582	509	0.596	0.589	ACVR1_MOUSE Activin receptor type-1 OS=Mus musculus OX=10090 GN=Acvr1 PE=1 SV=2
5	P80201	0.0	579	509	0.598	0.591	ACVR1_RAT Activin receptor type-1 OS=Rattus norvegicus OX=10116 GN=Acvr1 PE=2 SV=1
6	P80203	0.0	913	504	0.897	0.895	ACVL1_RAT Serine/threonine-protein kinase receptor R3 OS=Rattus norvegicus OX=10116 GN=Acvrl1 PE=1 SV=2
7	Q04771	0.0	587	509	0.600	0.593	ACVR1_HUMAN Activin receptor type-1 OS=Homo sapiens OX=9606 GN=ACVR1 PE=1 SV=1
8	Q61288	0.0	919	502	0.887	0.888	ACVL1_MOUSE Serine/threonine-protein kinase receptor R3 OS=Mus musculus OX=10090 GN=Acvrl1 PE=1 SV=2
9	Q8JFB0	0.0	556	499	0.563	0.567	Q8JFB0_DANRE receptor protein serine/threonine kinase OS=Danio rerio OX=7955 GN=alk1 PE=2 SV=1
10	Q90ZK6	0.0	594	504	0.596	0.595	ACVR1_CHICK Activin receptor type-1 OS=Gallus gallus OX=9031 GN=ACVR1 PE=2 SV=1
11	Q95U21	1.04e-167	486	535	0.501	0.471	Q95U21_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=sax PE=2 SV=1
12	Q7JQ36	1.98e-167	487	570	0.501	0.442	Q7JQ36_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=sax PE=2 SV=1
13	Q7JQ39	3.35e-167	486	570	0.501	0.442	Q7JQ39_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=sax PE=2 SV=1
14	A0A0B4K7J3	4.03e-167	486	582	0.501	0.433	A0A0B4K7J3_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=sax PE=3 SV=1
15	Q7JPN8	4.16e-167	486	570	0.499	0.440	Q7JPN8_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=sax PE=2 SV=1
16	Q7JPM7	5.64e-167	486	570	0.501	0.442	Q7JPM7_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=sax PE=2 SV=1
17	Q1RLX1	3.51e-148	436	527	0.443	0.423	Q1RLX1_DANRE receptor protein serine/threonine kinase OS=Danio rerio OX=7955 GN=zgc:136731 PE=2 SV=1
18	B3DJG0	4.86e-148	436	526	0.443	0.424	B3DJG0_DANRE receptor protein serine/threonine kinase OS=Danio rerio OX=7955 GN=bmpr1a PE=2 SV=1
19	B4DY26	2.79e-147	430	434	0.445	0.516	B4DY26_HUMAN receptor protein serine/threonine kinase OS=Homo sapiens OX=9606 GN=TGFBR1 PE=1 SV=1
20	P80204	3.25e-147	432	501	0.451	0.453	TGFR1_RAT TGF-beta receptor type-1 OS=Rattus norvegicus OX=10116 GN=Tgfbr1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	15	16.9	Phosphotransferase enzyme family
2	PF14316 DUF4381	4.6e+02	12.5	Domain of unknown function (DUF4381)
3	PF00069 Pkinase	4.5e-28	109.9	Protein kinase domain
4	PF17667 Pkinase_fungal	1.4e+02	12.6	Fungal protein kinase
5	PF07714 PK_Tyr_Ser-Thr	2e-31	120.8	Protein tyrosine and serine/threonine kinase
6	PF08515 TGF_beta_GS	3.8e-11	53.6	Transforming growth factor beta type I GS-motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000373574

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000295379	0.999	Bone morphogenetic protein 10
2	9606.ENSP00000463051	0.999	Growth/differentiation factor 2
3	9606.ENSP00000362299	0.998	Endoglin
4	9606.ENSP00000221930	0.995	Transforming growth factor beta-1
5	9606.ENSP00000238682	0.985	Transforming growth factor beta-3
6	9606.ENSP00000426568	0.982	Mothers against decapentaplegic homolog 1
7	9606.ENSP00000340361	0.975	Activin receptor type-2B
8	9606.ENSP00000351905	0.975	TGF-beta receptor type-2
9	9606.ENSP00000369154	0.970	Mothers against decapentaplegic homolog 9
10	9606.ENSP00000241416	0.969	Activin receptor type-2A
11	9606.ENSP00000441954	0.968	Mothers against decapentaplegic homolog 5
12	9606.ENSP00000339191	0.966	Caveolin-1
13	9606.ENSP00000365042	0.965	Casein kinase II subunit beta
14	9606.ENSP00000262158	0.964	Mothers against decapentaplegic homolog 7
15	9606.ENSP00000364133	0.949	TGF-beta receptor type-1
16	9606.ENSP00000242208	0.940	Inhibin beta A chain
17	9606.ENSP00000383003	0.934	Peptidyl-prolyl cis-trans isomerase FKBP1A
18	9606.ENSP00000363708	0.927	Bone morphogenetic protein receptor type-2
19	9606.ENSP00000326031	0.912	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
20	9606.ENSP00000368104	0.767	Bone morphogenetic protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004675	0.999	transmembrane receptor protein serine/threonine kinase activity
GO:0019838	0.998	growth factor binding
GO:0005024	0.816	transforming growth factor beta receptor activity
GO:0048185	0.688	activin binding
GO:0005102	0.338	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0070848	0.988	response to growth factor
GO:0007167	0.988	enzyme-linked receptor protein signaling pathway
GO:0007178	0.984	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0032501	0.983	multicellular organismal process
GO:0048856	0.981	anatomical structure development
GO:0071363	0.981	cellular response to growth factor stimulus
GO:0019222	0.970	regulation of metabolic process
GO:0071560	0.970	cellular response to transforming growth factor beta stimulus
GO:0009966	0.968	regulation of signal transduction
GO:0048522	0.966	positive regulation of cellular process
GO:0007275	0.963	multicellular organism development
GO:0060255	0.959	regulation of macromolecule metabolic process
GO:0051171	0.958	regulation of nitrogen compound metabolic process
GO:0030154	0.957	cell differentiation
GO:0080090	0.954	regulation of primary metabolic process
GO:0090092	0.954	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0009653	0.937	anatomical structure morphogenesis
GO:0048731	0.935	system development
GO:0007179	0.925	transforming growth factor beta receptor signaling pathway
GO:0090287	0.919	regulation of cellular response to growth factor stimulus
GO:0030509	0.918	BMP signaling pathway
GO:0016310	0.914	phosphorylation
GO:0090100	0.913	positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0048519	0.890	negative regulation of biological process
GO:0001936	0.878	regulation of endothelial cell proliferation
GO:0009889	0.875	regulation of biosynthetic process
GO:0071704	0.873	organic substance metabolic process
GO:0010604	0.869	positive regulation of macromolecule metabolic process
GO:0040012	0.862	regulation of locomotion
GO:0044238	0.860	primary metabolic process
GO:0001568	0.848	blood vessel development
GO:0051173	0.836	positive regulation of nitrogen compound metabolic process
GO:0001932	0.831	regulation of protein phosphorylation
GO:0031325	0.830	positive regulation of cellular metabolic process
GO:0043170	0.827	macromolecule metabolic process
GO:0048523	0.826	negative regulation of cellular process
GO:0010468	0.822	regulation of gene expression
GO:0006468	0.814	protein phosphorylation
GO:0019219	0.760	regulation of nucleobase-containing compound metabolic process
GO:2000026	0.738	regulation of multicellular organismal development
GO:0031326	0.711	regulation of cellular biosynthetic process
GO:0035239	0.680	tube morphogenesis
GO:0010556	0.670	regulation of macromolecule biosynthetic process
GO:2000145	0.661	regulation of cell motility
GO:0009888	0.660	tissue development
GO:0051240	0.647	positive regulation of multicellular organismal process
GO:0051094	0.620	positive regulation of developmental process
GO:0001945	0.611	lymph vessel development
GO:0048729	0.590	tissue morphogenesis
GO:0060393	0.578	regulation of pathway-restricted SMAD protein phosphorylation
GO:0048513	0.564	animal organ development
GO:0051252	0.556	regulation of RNA metabolic process
GO:1903506	0.541	regulation of nucleic acid-templated transcription
GO:0009891	0.534	positive regulation of biosynthetic process
GO:0030334	0.525	regulation of cell migration
GO:0031401	0.524	positive regulation of protein modification process
GO:0006355	0.518	regulation of DNA-templated transcription
GO:0045937	0.489	positive regulation of phosphate metabolic process
GO:0045595	0.484	regulation of cell differentiation
GO:0031328	0.458	positive regulation of cellular biosynthetic process
GO:0010557	0.457	positive regulation of macromolecule biosynthetic process
GO:0045935	0.457	positive regulation of nucleobase-containing compound metabolic process
GO:1903508	0.447	positive regulation of nucleic acid-templated transcription
GO:0045893	0.441	positive regulation of DNA-templated transcription
GO:0042327	0.432	positive regulation of phosphorylation
GO:0009892	0.416	negative regulation of metabolic process
GO:0006950	0.415	response to stress
GO:0001934	0.396	positive regulation of protein phosphorylation
GO:0010605	0.395	negative regulation of macromolecule metabolic process
GO:0006357	0.339	regulation of transcription by RNA polymerase II
GO:0048514	0.324	blood vessel morphogenesis
GO:0051128	0.304	regulation of cellular component organization
GO:0045597	0.303	positive regulation of cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0005622	0.839	intracellular anatomical structure
GO:0032991	0.529	protein-containing complex
GO:0009986	0.470	cell surface

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:18673	0.999	ATP + L-seryl-[receptor-protein] = ADP + H(+) + O-phospho-L-seryl-[receptor-protein]
EC:2.7.11.30	0.999	receptor protein serine/threonine kinase.

[back to server]