StarFunc result for job id P37088

User Input

>input (669 residues)
MEGNKLEEQDSSPPQSTPGLMKGNKREEQGLGPEPAAPQQPTAEEEALIEFHRSYRELFE
FFCNNTTIHGAIRLVCSQHNRMKTAFWAVLWLCTFGMMYWQFGLLFGEYFSYPVSLNINL
NSDKLVFPAVTICTLNPYRYPEIKEELEELDRITEQTLFDLYKYSSFTTLVAGSRSRRDL
RGTLPHPLQRLRVPPPPHGARRARSVASSLRDNNPQVDWKDWKIGFQLCNQNKSDCFYQT
YSSGVDAVREWYRFHYINILSRLPETLPSLEEDTLGNFIFACRFNQVSCNQANYSHFHHP
MYGNCYTFNDKNNSNLWMSSMPGINNGLSLMLRAEQNDFIPLLSTVTGARVMVHGQDEPA
FMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDVPVENLYPSKYTQQVCIHSC
FQESMIKECGCAYIFYPRPQNVEYCDYRKHSSWGYCYYKLQVDFSSDHLGCFTKCRKPCS
VTSYQLSAGYSRWPSVTSQEWVFQMLSRQNNYTVNNKRNGVAKVNIFFKELNYKTNSESP
SVTMVTLLSNLGSQWSLWFGSSVLSVVEMAELVFDLLVIMFLMLLRRFRSRYWSPGRGGR
GAQEVASTLASSPPSHFCPHPMSLSLSQPGPAPSPALTAPPPAYATLGPRPSPGGSAGAS
SSTCPLGGP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P37088	1.000	1.000	0.000	669	1.000	1.000	P37088.pdb.gz	SCNNA_HUMAN Amiloride-sensitive sodium channel subunit alpha OS=Homo sapiens OX=9606 GN=SCNN1A PE=1 SV=1
2	AFDB:Q61180	0.865	0.830	0.000	699	0.830	0.794	Q61180.pdb.gz	SCNNA_MOUSE Amiloride-sensitive sodium channel subunit alpha OS=Mus musculus OX=10090 GN=Scnn1a PE=1 SV=2
3	AFDB:H1AFJ5	0.759	0.774	1.496E-77	655	0.463	0.473	H1AFJ5.pdb.gz	SCNNA_NEOFS Amiloride-sensitive sodium channel subunit alpha OS=Neoceratodus forsteri OX=7892 GN=scnn1a PE=1 SV=1
4	PDB:6wthA	0.563	0.984	2.417E-68	381	0.568	0.997	6wthA.pdb.gz	Molecular principles of assembly, activation, and inhibition in epithelial sodium channel.
5	AFDB:P51172	0.639	0.537	4.000E-64	802	0.356	0.297	P51172.pdb.gz	SCNND_HUMAN Amiloride-sensitive sodium channel subunit delta OS=Homo sapiens OX=9606 GN=SCNN1D PE=1 SV=3
6	AFDB:H1AFJ7	0.670	0.685	7.942E-58	653	0.315	0.323	H1AFJ7.pdb.gz	SCNNG_NEOFS Amiloride-sensitive sodium channel subunit gamma OS=Neoceratodus forsteri OX=7892 GN=scnn1g PE=2 SV=1
7	AFDB:Q9WU39	0.652	0.665	2.045E-56	655	0.314	0.321	Q9WU39.pdb.gz	SCNNG_MOUSE Amiloride-sensitive sodium channel subunit gamma OS=Mus musculus OX=10090 GN=Scnn1g PE=1 SV=1
8	AFDB:H1AFJ6	0.680	0.698	1.650E-55	651	0.321	0.330	H1AFJ6.pdb.gz	SCNNB_NEOFS Amiloride-sensitive sodium channel subunit beta OS=Neoceratodus forsteri OX=7892 GN=scnn1b PE=2 SV=1
9	AFDB:P51168	0.695	0.725	1.585E-54	640	0.297	0.311	P51168.pdb.gz	SCNNB_HUMAN Amiloride-sensitive sodium channel subunit beta OS=Homo sapiens OX=9606 GN=SCNN1B PE=1 SV=2
10	AFDB:P37090	0.688	0.719	2.421E-53	638	0.299	0.313	P37090.pdb.gz	SCNNB_RAT Amiloride-sensitive sodium channel subunit beta OS=Rattus norvegicus OX=10116 GN=Scnn1b PE=1 SV=2
11	PDB:6wthC	0.550	0.930	3.088E-41	389	0.230	0.396	6wthC.pdb.gz	Molecular principles of assembly, activation, and inhibition in epithelial sodium channel.
12	PDB:6wthB	0.543	0.864	9.249E-38	413	0.211	0.341	6wthB.pdb.gz	Molecular principles of assembly, activation, and inhibition in epithelial sodium channel.
13	AFDB:Q21974	0.591	0.515	1.198E-37	777	0.232	0.199	Q21974.pdb.gz	UNC8_CAEEL Degenerin unc-8 OS=Caenorhabditis elegans OX=6239 GN=unc-8 PE=2 SV=1
14	PDB:6vtkA	0.478	0.691	4.044E-29	446	0.158	0.238	6vtkA.pdb.gz
15	PDB:7jncA	0.179	0.333	2.164E-2	287	0.069	0.160	7jncA.pdb.gz
16	PDB:6vlzv	0.062	0.060	5.474E-2	712	0.051	0.048	6vlzv.pdb.gz	Structures of the human mitochondrial ribosome bound to EF-G1 reveal distinct features of mitochondrial translation elongation.
17	PDB:4pxdA	0.075	0.106	5.801E-2	411	0.037	0.061	4pxdA.pdb.gz	Structural insights into the substrate specificity of (s)-ureidoglycolate amidohydrolase and its comparison with allantoate amidohydrolase.
18	PDB:5dhmC	0.039	0.079	2.115	268	0.010	0.026	5dhmC.pdb.gz	Structure of the fimbrial protein Mfa4 from Porphyromonas gingivalis in its precursor form: implications for a donor-strand complementation mechanism.
19	PDB:3j6b6	0.054	0.135	2.996	209	0.037	0.120	3j6b6.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
20	PDB:6sklD	0.046	0.102	3.365	243	0.021	0.058	6sklD.pdb.gz	Cryo-EM Structure of the Fork Protection Complex Bound to CMG at a Replication Fork.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H1AFJ5	0.0	658	655	0.460	0.470	SCNNA_NEOFS Amiloride-sensitive sodium channel subunit alpha OS=Neoceratodus forsteri OX=7892 GN=scnn1a PE=1 SV=1
2	P37088	0.0	1398	669	1.000	1.000	SCNNA_HUMAN Amiloride-sensitive sodium channel subunit alpha OS=Homo sapiens OX=9606 GN=SCNN1A PE=1 SV=1
3	P37089	0.0	1124	698	0.834	0.799	SCNNA_RAT Amiloride-sensitive sodium channel subunit alpha OS=Rattus norvegicus OX=10116 GN=Scnn1a PE=1 SV=2
4	Q61180	0.0	1119	699	0.830	0.794	SCNNA_MOUSE Amiloride-sensitive sodium channel subunit alpha OS=Mus musculus OX=10090 GN=Scnn1a PE=1 SV=2
5	P51172	7.90e-142	435	802	0.333	0.278	SCNND_HUMAN Amiloride-sensitive sodium channel subunit delta OS=Homo sapiens OX=9606 GN=SCNN1D PE=1 SV=3
6	P37091	9.84e-125	386	650	0.321	0.331	SCNNG_RAT Amiloride-sensitive sodium channel subunit gamma OS=Rattus norvegicus OX=10116 GN=Scnn1g PE=1 SV=2
7	Q9WU39	1.38e-123	383	655	0.317	0.324	SCNNG_MOUSE Amiloride-sensitive sodium channel subunit gamma OS=Mus musculus OX=10090 GN=Scnn1g PE=1 SV=1
8	H1AFJ7	1.75e-123	383	653	0.327	0.335	SCNNG_NEOFS Amiloride-sensitive sodium channel subunit gamma OS=Neoceratodus forsteri OX=7892 GN=scnn1g PE=2 SV=1
9	H1AFJ6	2.04e-123	382	651	0.305	0.313	SCNNB_NEOFS Amiloride-sensitive sodium channel subunit beta OS=Neoceratodus forsteri OX=7892 GN=scnn1b PE=2 SV=1
10	A5X2V1	8.45e-123	381	649	0.294	0.304	A5X2V1_HUMAN Amiloride-sensitive sodium channel gamma-subunit OS=Homo sapiens OX=9606 GN=SCNN1G PE=2 SV=1
11	P51170	8.45e-123	381	649	0.294	0.304	SCNNG_HUMAN Amiloride-sensitive sodium channel subunit gamma OS=Homo sapiens OX=9606 GN=SCNN1G PE=1 SV=4
12	P51168	1.45e-106	338	640	0.290	0.303	SCNNB_HUMAN Amiloride-sensitive sodium channel subunit beta OS=Homo sapiens OX=9606 GN=SCNN1B PE=1 SV=2
13	P37090	3.46e-106	337	638	0.297	0.312	SCNNB_RAT Amiloride-sensitive sodium channel subunit beta OS=Rattus norvegicus OX=10116 GN=Scnn1b PE=1 SV=2
14	Q9WU38	6.90e-106	337	638	0.303	0.318	SCNNB_MOUSE Amiloride-sensitive sodium channel subunit beta OS=Mus musculus OX=10090 GN=Scnn1b PE=1 SV=1
15	Q16515	1.45e-39	154	512	0.181	0.236	ASIC2_HUMAN Acid-sensing ion channel 2 OS=Homo sapiens OX=9606 GN=ASIC2 PE=1 SV=1
16	Q925H0	3.49e-39	153	512	0.179	0.234	ASIC2_MOUSE Acid-sensing ion channel 2 OS=Mus musculus OX=10090 GN=Asic2 PE=1 SV=1
17	Q62962	6.22e-39	152	512	0.179	0.234	ASIC2_RAT Acid-sensing ion channel 2 OS=Rattus norvegicus OX=10116 GN=Asic2 PE=1 SV=1
18	A0A060D4V3	1.41e-36	142	356	0.123	0.230	A0A060D4V3_ONCMY Acid-sensing ion channel 1 (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=ASIC1 PE=2 SV=1
19	Q708S8	8.81e-35	141	557	0.127	0.153	ASI1B_DANRE Acid-sensing ion channel 1B OS=Danio rerio OX=7955 GN=asic1b PE=2 SV=1
20	Q21974	1.08e-34	143	777	0.142	0.122	UNC8_CAEEL Degenerin unc-8 OS=Caenorhabditis elegans OX=6239 GN=unc-8 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00858 ASC	6e-106	366.7	Amiloride-sensitive sodium channel
2	PF19337 BAMBI_C	1.1e+02	14.0	BMP and activin membrane-bound inhibitor homolog C-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353292

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000383199	0.998	E3 ubiquitin-protein ligase NEDD4-like
2	9606.ENSP00000300061	0.997	Amiloride-sensitive sodium channel subunit gamma
3	9606.ENSP00000345751	0.997	Amiloride-sensitive sodium channel subunit beta
4	9606.ENSP00000424827	0.987	E3 ubiquitin-protein ligase NEDD4
5	9606.ENSP00000246914	0.970	Serine/threonine-protein kinase WNK4
6	9606.ENSP00000356832	0.969	Serine/threonine-protein kinase Sgk1
7	9606.ENSP00000341292	0.959	Serine/threonine-protein kinase WNK1
8	9606.ENSP00000297954	0.945	Serine/threonine-protein kinase WNK2
9	9606.ENSP00000346667	0.942	Serine/threonine-protein kinase WNK3
10	9606.ENSP00000361458	0.941	TSC22 domain family protein 3
11	9606.ENSP00000368411	0.930	Amiloride-sensitive sodium channel subunit delta
12	9606.ENSP00000427793	0.927	NEDD4-like E3 ubiquitin-protein ligase WWP1
13	9606.ENSP00000396915	0.914	Sodium channel subunit beta-1
14	9606.ENSP00000340608	0.907	Serine/threonine-protein kinase Sgk2
15	9606.ENSP00000304697	0.904	Polyubiquitin-B
16	9606.ENSP00000396320	0.904	Sodium channel protein type 4 subunit alpha
17	9606.ENSP00000441543	0.904	Polyubiquitin-C
18	9606.ENSP00000272317	0.902	Ubiquitin-40S ribosomal protein S27a
19	9606.ENSP00000322460	0.902	Sodium channel subunit beta-4
20	9606.ENSP00000251849	0.901	RAF proto-oncogene serine/threonine-protein kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0050699	1.000	WW domain binding
GO:0015280	1.000	ligand-gated sodium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0006814	0.995	sodium ion transport
GO:0098657	0.991	import into cell
GO:0055078	0.991	sodium ion homeostasis
GO:0035725	0.991	sodium ion transmembrane transport
GO:0071495	0.982	cellular response to endogenous stimulus
GO:0070887	0.981	cellular response to chemical stimulus
GO:1901698	0.980	response to nitrogen compound
GO:0065007	0.977	biological regulation
GO:0098739	0.977	import across plasma membrane
GO:0006873	0.977	intracellular monoatomic ion homeostasis
GO:1902075	0.971	cellular response to salt
GO:0098659	0.967	inorganic cation import across plasma membrane
GO:0010033	0.958	response to organic substance
GO:0032501	0.947	multicellular organismal process
GO:0065008	0.892	regulation of biological quality
GO:0050878	0.878	regulation of body fluid levels
GO:0071310	0.835	cellular response to organic substance
GO:0014070	0.803	response to organic cyclic compound
GO:0030003	0.796	intracellular monoatomic cation homeostasis
GO:1901699	0.792	cellular response to nitrogen compound
GO:0010243	0.749	response to organonitrogen compound
GO:0071417	0.732	cellular response to organonitrogen compound
GO:0009268	0.695	response to pH
GO:0071407	0.660	cellular response to organic cyclic compound
GO:0071467	0.653	cellular response to pH
GO:0048871	0.631	multicellular organismal-level homeostasis
GO:0010447	0.566	response to acidic pH
GO:0140962	0.523	multicellular organismal-level chemical homeostasis
GO:0006883	0.347	intracellular sodium ion homeostasis
GO:0050789	0.338	regulation of biological process
GO:0050794	0.311	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0034706	0.998	sodium channel complex
GO:0005622	0.995	intracellular anatomical structure
GO:0005576	0.955	extracellular region
GO:0043227	0.936	membrane-bounded organelle
GO:0043230	0.876	extracellular organelle
GO:0005737	0.872	cytoplasm
GO:1903561	0.856	extracellular vesicle
GO:0005615	0.839	extracellular space
GO:0070062	0.830	extracellular exosome
GO:0043229	0.740	intracellular organelle
GO:0043231	0.725	intracellular membrane-bounded organelle
GO:0120025	0.677	plasma membrane bounded cell projection
GO:0016324	0.626	apical plasma membrane
GO:0012505	0.438	endomembrane system
GO:0005634	0.336	nucleus
GO:0005929	0.322	cilium
GO:0005829	0.314	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	1.000	Na(+)(in) = Na(+)(out)

[back to server]