StarFunc result for job id P37173

User Input

>input (567 residues)
MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFST
CDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPK
CIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQVTGISLLPPLGVAI
SVIIIFYCYRVNRQQKLSSTWETGKTRKLMEFSEHCAIILEDDRSDISSTCANNINHNTE
LLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLK
HENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLARGIAH
LHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG
TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVRE
HPCVESMKDNVLRDRGRPEIPSFWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSE
LEHLDRLSGRSCSEEKIPEDGSLNTTK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P37173	1.000	1.000	0.000	567	1.000	1.000	P37173.pdb.gz	TGFR2_HUMAN TGF-beta receptor type-2 OS=Homo sapiens OX=9606 GN=TGFBR2 PE=1 SV=2
2	AFDB:Q90999	0.600	0.610	1.335E-90	557	0.743	0.756	Q90999.pdb.gz	TGFR2_CHICK TGF-beta receptor type-2 OS=Gallus gallus OX=9031 GN=TGFBR2 PE=1 SV=1
3	AFDB:F1QKF4	0.712	0.725	2.182E-81	556	0.656	0.669	F1QKF4.pdb.gz
4	AFDB:F1NCI7	0.498	0.550	1.003E-42	512	0.321	0.355	F1NCI7.pdb.gz
5	AFDB:P27040	0.506	0.534	4.250E-42	536	0.326	0.345	P27040.pdb.gz	AVR2B_MOUSE Activin receptor type-2B OS=Mus musculus OX=10090 GN=Acvr2b PE=1 SV=1
6	AFDB:P38445	0.503	0.553	6.628E-42	513	0.328	0.363	P38445.pdb.gz	AVR2B_RAT Activin receptor type-2B OS=Rattus norvegicus OX=10116 GN=Acvr2b PE=1 SV=3
7	AFDB:F1QLL7	0.506	0.561	9.248E-42	509	0.302	0.336	F1QLL7.pdb.gz
8	AFDB:A9CAY0	0.509	0.560	1.801E-41	514	0.298	0.329	A9CAY0.pdb.gz
9	AFDB:F1R4D0	0.514	0.541	2.127E-41	538	0.317	0.335	F1R4D0.pdb.gz
10	AFDB:P27037	0.499	0.550	2.317E-40	513	0.309	0.341	P27037.pdb.gz	AVR2A_HUMAN Activin receptor type-2A OS=Homo sapiens OX=9606 GN=ACVR2A PE=1 SV=1
11	PDB:8dksA	0.355	0.678	9.768E-16	283	0.122	0.244	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
12	PDB:2bujA	0.389	0.728	2.375E-15	291	0.108	0.210	2bujA.pdb.gz	Crystal Structure of the Human Serine-Threonine Kinase 16 in Complex with Staurosporine
13	PDB:6s73A	0.381	0.763	6.106E-15	269	0.104	0.219	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
14	PDB:4krcA	0.378	0.686	7.625E-15	297	0.116	0.222	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
15	PDB:5u6yA	0.371	0.452	2.891E-14	459	0.122	0.150	5u6yA.pdb.gz
16	PDB:4zhxA	0.394	0.534	3.610E-14	409	0.123	0.171	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
17	PDB:2zoqA	0.365	0.571	4.034E-14	352	0.118	0.190	2zoqA.pdb.gz	Crystal structure of human mono-phosphorylated ERK1 at Tyr204
18	PDB:6lk5A	0.362	0.729	4.508E-14	265	0.113	0.242	6lk5A.pdb.gz
19	PDB:1k9aB	0.378	0.479	4.766E-14	441	0.120	0.154	1k9aB.pdb.gz
20	PDB:4eomC	0.368	0.716	7.030E-14	276	0.109	0.225	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P37173	0.0	1181	567	1.000	1.000	TGFR2_HUMAN TGF-beta receptor type-2 OS=Homo sapiens OX=9606 GN=TGFBR2 PE=1 SV=2
2	P38438	0.0	1098	567	0.915	0.915	TGFR2_RAT TGF-beta receptor type-2 OS=Rattus norvegicus OX=10116 GN=Tgfbr2 PE=1 SV=1
3	Q58EQ1	0.0	706	556	0.638	0.651	Q58EQ1_DANRE TGF-beta receptor type-2 OS=Danio rerio OX=7955 GN=tgfbr2 PE=2 SV=1
4	Q62312	0.0	1104	567	0.922	0.922	TGFR2_MOUSE TGF-beta receptor type-2 OS=Mus musculus OX=10090 GN=Tgfbr2 PE=1 SV=2
5	Q90999	0.0	869	557	0.739	0.752	TGFR2_CHICK TGF-beta receptor type-2 OS=Gallus gallus OX=9031 GN=TGFBR2 PE=1 SV=1
6	Q90669	4.61e-92	293	513	0.293	0.324	AVR2A_CHICK Activin receptor type-2A OS=Gallus gallus OX=9031 GN=ACVR2A PE=2 SV=1
7	Q90670	1.31e-89	287	512	0.302	0.334	AVR2B_CHICK Activin receptor type-2B OS=Gallus gallus OX=9031 GN=ACVR2B PE=2 SV=1
8	P27040	2.49e-88	285	536	0.314	0.332	AVR2B_MOUSE Activin receptor type-2B OS=Mus musculus OX=10090 GN=Acvr2b PE=1 SV=1
9	Q13705	2.78e-88	283	512	0.309	0.342	AVR2B_HUMAN Activin receptor type-2B OS=Homo sapiens OX=9606 GN=ACVR2B PE=1 SV=3
10	P27037	3.14e-88	283	513	0.286	0.316	AVR2A_HUMAN Activin receptor type-2A OS=Homo sapiens OX=9606 GN=ACVR2A PE=1 SV=1
11	P27038	3.76e-88	283	513	0.286	0.316	AVR2A_MOUSE Activin receptor type-2A OS=Mus musculus OX=10090 GN=Acvr2a PE=1 SV=1
12	Q66T47	4.20e-88	283	512	0.309	0.342	AVR2B_PIG Activin receptor type-2B OS=Sus scrofa OX=9823 GN=ACVR2B PE=2 SV=1
13	P38444	1.70e-87	281	513	0.282	0.312	AVR2A_RAT Activin receptor type-2A OS=Rattus norvegicus OX=10116 GN=Acvr2a PE=1 SV=1
14	F1QG01	1.53e-86	279	514	0.286	0.315	F1QG01_DANRE Serine/threonine-protein kinase receptor OS=Danio rerio OX=7955 GN=actr2a PE=3 SV=1
15	P38445	3.59e-86	278	513	0.309	0.341	AVR2B_RAT Activin receptor type-2B OS=Rattus norvegicus OX=10116 GN=Acvr2b PE=1 SV=3
16	Q9YGU4	8.75e-86	277	509	0.298	0.332	Q9YGU4_DANRE Serine/threonine-protein kinase receptor OS=Danio rerio OX=7955 GN=ActrIIB PE=1 SV=1
17	Q24229	7.43e-79	259	516	0.272	0.298	Q24229_DROME Serine/threonine-protein kinase receptor OS=Drosophila melanogaster OX=7227 GN=put PE=2 SV=1
18	A0A0B4KG59	9.14e-79	259	520	0.272	0.296	A0A0B4KG59_DROME Serine/threonine-protein kinase receptor OS=Drosophila melanogaster OX=7227 GN=put PE=1 SV=1
19	Q24468	1.01e-78	259	516	0.272	0.298	Q24468_DROME Serine/threonine-protein kinase receptor OS=Drosophila melanogaster OX=7227 GN=put PE=1 SV=1
20	B4DY26	4.86e-72	239	434	0.256	0.334	B4DY26_HUMAN receptor protein serine/threonine kinase OS=Homo sapiens OX=9606 GN=TGFBR1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	1.6	19.4	ABC1 atypical kinase-like domain
2	PF01636 APH	1.2e+02	13.9	Phosphotransferase enzyme family
3	PF08917 ecTbetaR2	9.6e-40	146.3	Transforming growth factor beta receptor 2 ectodomain
4	PF12330 Haspin_kinase	36	14.8	Haspin like kinase domain
5	PF00069 Pkinase	1.2e-31	121.6	Protein kinase domain
6	PF17667 Pkinase_fungal	47	14.2	Fungal protein kinase
7	PF07714 PK_Tyr_Ser-Thr	4.7e-33	126.1	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000005897

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000008195	0.998	Transforming growth factor, beta 3
2	60711.ENSCSAP00000014519	0.998	Transforming growth factor, beta 1
3	60711.ENSCSAP00000007285	0.995	Receptor protein serine/threonine kinase
4	60711.ENSCSAP00000014041	0.984	Mothers against decapentaplegic homolog
5	60711.ENSCSAP00000014035	0.979	Mothers against decapentaplegic homolog
6	60711.ENSCSAP00000014115	0.979	Mothers against decapentaplegic homolog
7	60711.ENSCSAP00000009443	0.978	Mothers against decapentaplegic homolog
8	60711.ENSCSAP00000002139	0.963	Serine/threonine-protein kinase receptor
9	60711.ENSCSAP00000013793	0.962	SMAD specific E3 ubiquitin protein ligase 1
10	60711.ENSCSAP00000005828	0.940	Death-domain associated protein
11	60711.ENSCSAP00000016563	0.934	Transforming growth factor, beta receptor III
12	60711.ENSCSAP00000009996	0.933	Endoglin
13	60711.ENSCSAP00000014820	0.932	Yes-associated protein 1
14	60711.ENSCSAP00000001674	0.927	Growth differentiation factor 15
15	60711.ENSCSAP00000011176	0.916	Ras homolog family member A
16	60711.ENSCSAP00000011799	0.912	Transforming growth factor, beta 2
17	60711.ENSCSAP00000016061	0.892	SHC adaptor protein 1
18	60711.ENSCSAP00000002134	0.886	Receptor protein serine/threonine kinase
19	60711.ENSCSAP00000000184	0.867	Belongs to the integrin beta chain family.
20	60711.ENSCSAP00000009415	0.852	Mothers against decapentaplegic homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019838	0.998	growth factor binding
GO:0004675	0.998	transmembrane receptor protein serine/threonine kinase activity
GO:0046332	0.997	SMAD binding
GO:0019955	0.997	cytokine binding
GO:0005102	0.997	signaling receptor binding
GO:0050431	0.994	transforming growth factor beta binding
GO:0005024	0.994	transforming growth factor beta receptor activity
GO:0005126	0.914	cytokine receptor binding
GO:0005160	0.889	transforming growth factor beta receptor binding
GO:0097367	0.700	carbohydrate derivative binding
GO:0044877	0.575	protein-containing complex binding
GO:0042802	0.451	identical protein binding
GO:0043167	0.354	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.988	cellular metabolic process
GO:0007167	0.987	enzyme-linked receptor protein signaling pathway
GO:0070848	0.985	response to growth factor
GO:0071495	0.983	cellular response to endogenous stimulus
GO:0016310	0.983	phosphorylation
GO:0072359	0.978	circulatory system development
GO:0051240	0.976	positive regulation of multicellular organismal process
GO:0007178	0.973	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0071363	0.969	cellular response to growth factor stimulus
GO:0050793	0.965	regulation of developmental process
GO:0048522	0.947	positive regulation of cellular process
GO:0007179	0.947	transforming growth factor beta receptor signaling pathway
GO:0071704	0.930	organic substance metabolic process
GO:0001932	0.930	regulation of protein phosphorylation
GO:0010717	0.929	regulation of epithelial to mesenchymal transition
GO:0010718	0.918	positive regulation of epithelial to mesenchymal transition
GO:0006807	0.915	nitrogen compound metabolic process
GO:0008284	0.911	positive regulation of cell population proliferation
GO:0001944	0.905	vasculature development
GO:1901564	0.903	organonitrogen compound metabolic process
GO:0009653	0.895	anatomical structure morphogenesis
GO:0006468	0.874	protein phosphorylation
GO:0048514	0.867	blood vessel morphogenesis
GO:0033993	0.860	response to lipid
GO:0003170	0.827	heart valve development
GO:0002682	0.817	regulation of immune system process
GO:0010604	0.806	positive regulation of macromolecule metabolic process
GO:0048869	0.798	cellular developmental process
GO:0030154	0.791	cell differentiation
GO:0003179	0.781	heart valve morphogenesis
GO:0030324	0.780	lung development
GO:0014070	0.770	response to organic cyclic compound
GO:0048583	0.769	regulation of response to stimulus
GO:0023051	0.763	regulation of signaling
GO:0010646	0.763	regulation of cell communication
GO:0030155	0.740	regulation of cell adhesion
GO:1901700	0.738	response to oxygen-containing compound
GO:0051247	0.728	positive regulation of protein metabolic process
GO:2000026	0.715	regulation of multicellular organismal development
GO:0006950	0.680	response to stress
GO:0048519	0.680	negative regulation of biological process
GO:0031325	0.660	positive regulation of cellular metabolic process
GO:0048523	0.656	negative regulation of cellular process
GO:0060485	0.653	mesenchyme development
GO:0010628	0.644	positive regulation of gene expression
GO:0009967	0.592	positive regulation of signal transduction
GO:0060393	0.586	regulation of pathway-restricted SMAD protein phosphorylation
GO:0010556	0.584	regulation of macromolecule biosynthetic process
GO:0030097	0.541	hemopoiesis
GO:0090092	0.522	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0031401	0.504	positive regulation of protein modification process
GO:0009790	0.503	embryo development
GO:0045937	0.497	positive regulation of phosphate metabolic process
GO:0009887	0.483	animal organ morphogenesis
GO:0001934	0.458	positive regulation of protein phosphorylation
GO:0090100	0.442	positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0002684	0.346	positive regulation of immune system process
GO:0097305	0.315	response to alcohol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.997	plasma membrane
GO:0005622	0.963	intracellular anatomical structure
GO:0005737	0.865	cytoplasm
GO:0009986	0.805	cell surface
GO:0043227	0.740	membrane-bounded organelle
GO:0098552	0.696	side of membrane
GO:0009897	0.640	external side of plasma membrane
GO:0043229	0.622	intracellular organelle
GO:0005634	0.611	nucleus
GO:0032991	0.393	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:18673	0.998	ATP + L-seryl-[receptor-protein] = ADP + H(+) + O-phospho-L-seryl-[receptor-protein]
EC:2.7.11.30	0.998	receptor protein serine/threonine kinase.

[back to server]