StarFunc result for job id P37198

User Input

>input (522 residues)
MSGFNFGGTGAPTGGFTFGTAKTATTTPATGFSFSTSGTGGFNFGAPFQPATSTPSTGLF
SLATQTPATQTTGFTFGTATLASGGTGFSLGIGASKLNLSNTAATPAMANPSGFGLGSSN
LTNAISSTVTSSQGTAPTGFVFGPSTTSVAPATTSGGFSFTGGSTAQPSGFNIGSAGNSA
QPTAPATLPFTPATPAATTAGATQPAAPTPTATITSTGPSLFASIATAPTSSATTGLSLC
TPVTTAGAPTAGTQGFSLKAPGAASGTSTTTSTAATATATTTSSSSTTGFALNLKPLAPA
GIPSNTAAAVTAPPGPGAAAGAAASSAMTYAQLESLINKWSLELEDQERHFLQQATQVNA
WDRTLIENGEKITSLHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEELVKEQSGT
IYLQHADEEREKTYKLAENIDAQLKRMAQDLKDIIEHLNTSGAPADTSDPLQQICKILNA
HMDSLQWIDQNSALLQRKVEEVTKVCEGRRKEQERSFRITFD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024QZF1	0.395	0.395	4.862E-62	522	1.000	1.000	A0A024QZF1.pdb.gz
2	AFDB:Q63850	0.420	0.417	1.084E-47	526	0.803	0.797	Q63850.pdb.gz	NUP62_MOUSE Nuclear pore glycoprotein p62 OS=Mus musculus OX=10090 GN=Nup62 PE=1 SV=2
3	AFDB:Q91349	0.397	0.380	8.111E-29	547	0.536	0.512	Q91349.pdb.gz	Q91349_XENLA IL4I1 protein OS=Xenopus laevis OX=8355 GN=nup62.L PE=1 SV=1
4	AFDB:A0A060VZ42	0.394	0.356	3.859E-28	579	0.571	0.515	A0A060VZ42.pdb.gz	A0A060VZ42_ONCMY Nucleoporin NSP1-like C-terminal domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00081146001 PE=3 SV=1
5	AFDB:A0A2R8QTE7	0.403	0.411	4.773E-28	511	0.498	0.509	A0A2R8QTE7.pdb.gz
6	AFDB:Q5B4N1	0.349	0.293	9.609E-11	624	0.278	0.232	Q5B4N1.pdb.gz	Q5B4N1_EMENI Nuclear pore complex protein An-Nsp1 (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04499 PE=3 SV=1
7	AFDB:Q10168	0.324	0.284	2.593E-10	598	0.318	0.278	Q10168.pdb.gz	NSP1_SCHPO Nucleoporin nsp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nsp1 PE=1 SV=1
8	AFDB:Q8L7F7	0.344	0.248	5.284E-8	739	0.266	0.188	Q8L7F7.pdb.gz	NUP62_ARATH Nuclear pore complex protein NUP62 OS=Arabidopsis thaliana OX=3702 GN=NUP62 PE=1 SV=1
9	AFDB:Q381M9	0.334	0.324	1.332E-5	539	0.226	0.219	Q381M9.pdb.gz	Q381M9_TRYB2 Nucleoporin NSP1-like C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.7200 PE=3 SV=1
10	AFDB:Q5JR59	0.174	0.070	2.707E-5	1369	0.188	0.072	Q5JR59.pdb.gz	MTUS2_HUMAN Microtubule-associated tumor suppressor candidate 2 OS=Homo sapiens OX=9606 GN=MTUS2 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	M0QXN5	0.0	728	446	0.778	0.910	M0QXN5_HUMAN Nucleoporin 62 OS=Homo sapiens OX=9606 GN=NUP62 PE=1 SV=1
2	P17955	0.0	600	525	0.795	0.790	NUP62_RAT Nuclear pore glycoprotein p62 OS=Rattus norvegicus OX=10116 GN=Nup62 PE=1 SV=1
3	P37198	0.0	1027	522	1.000	1.000	NUP62_HUMAN Nuclear pore glycoprotein p62 OS=Homo sapiens OX=9606 GN=NUP62 PE=1 SV=3
4	Q63850	0.0	627	526	0.791	0.785	NUP62_MOUSE Nuclear pore glycoprotein p62 OS=Mus musculus OX=10090 GN=Nup62 PE=1 SV=2
5	Q91349	1.09e-157	462	547	0.580	0.554	Q91349_XENLA IL4I1 protein OS=Xenopus laevis OX=8355 GN=nup62.L PE=1 SV=1
6	O57397	3.29e-143	426	579	0.571	0.515	O57397_ONCMY Nuclear pore complex glycoprotein p62 OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
7	A8WFZ2	3.61e-135	403	507	0.531	0.546	A8WFZ2_DANRE Nuclear pore glycoprotein p62 OS=Danio rerio OX=7955 GN=fb13d02 PE=1 SV=1
8	E9QIQ3	2.11e-134	401	507	0.533	0.548	E9QIQ3_DANRE Nuclear pore glycoprotein p62 isoform X1 OS=Danio rerio OX=7955 GN=fb13d02 PE=1 SV=2
9	M0R302	2.56e-80	248	137	0.262	1.000	M0R302_HUMAN Nucleoporin 62 (Fragment) OS=Homo sapiens OX=9606 GN=NUP62 PE=1 SV=8
10	M0QX64	1.99e-78	243	134	0.257	1.000	M0QX64_HUMAN Nucleoporin 62 (Fragment) OS=Homo sapiens OX=9606 GN=NUP62 PE=1 SV=1
11	A0A0S2Z5B5	2.89e-73	233	221	0.220	0.520	A0A0S2Z5B5_HUMAN Nucleoporin 62kDa C-terminal like isoform 2 (Fragment) OS=Homo sapiens OX=9606 GN=NUP62CL PE=1 SV=1
12	Q7JXF5	6.05e-63	213	394	0.188	0.249	NUP62_DROME Nuclear pore glycoprotein p62 OS=Drosophila melanogaster OX=7227 GN=Nup62 PE=1 SV=1
13	Q9H1M0	2.57e-47	164	184	0.163	0.462	N62CL_HUMAN Nucleoporin-62 C-terminal-like protein OS=Homo sapiens OX=9606 GN=NUP62CL PE=1 SV=3
14	Q5B4N1	1.04e-32	134	624	0.128	0.107	Q5B4N1_EMENI Nuclear pore complex protein An-Nsp1 (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04499 PE=3 SV=1
15	Q10168	5.90e-31	129	598	0.307	0.268	NSP1_SCHPO Nucleoporin nsp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nsp1 PE=1 SV=1
16	Q86IX4	2.41e-29	124	709	0.121	0.089	Q86IX4_DICDI Nuclear pore protein OS=Dictyostelium discoideum OX=44689 GN=nup62 PE=3 SV=1
17	Q8L7F7	1.40e-25	113	739	0.096	0.068	NUP62_ARATH Nuclear pore complex protein NUP62 OS=Arabidopsis thaliana OX=3702 GN=NUP62 PE=1 SV=1
18	P14907	4.26e-25	112	823	0.107	0.068	NSP1_YEAST Nucleoporin NSP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NSP1 PE=1 SV=1
19	Q381M9	3.51e-10	64.7	539	0.073	0.071	Q381M9_TRYB2 Nucleoporin NSP1-like C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.7200 PE=3 SV=1
20	A0A060VZ42	1.14e-05	50.4	579	0.201	0.181	A0A060VZ42_ONCMY Nucleoporin NSP1-like C-terminal domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00081146001 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13747 DUF4164	72	15.1	Domain of unknown function (DUF4164)
2	PF02601 Exonuc_VII_L	1.3e+02	13.6	Exonuclease VII, large subunit
3	PF05064 Nsp1_C	5.6e-31	118.1	Nsp1-like C-terminal region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000471191

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000219169	0.999	Nuclear transport factor 2
2	9606.ENSP00000264883	0.999	Nucleoporin p54
3	9606.ENSP00000310668	0.999	Nuclear pore complex protein Nup93
4	9606.ENSP00000352400	0.999	Nuclear pore complex protein Nup214
5	9606.ENSP00000458954	0.999	Nuclear pore complex protein Nup88
6	9606.ENSP00000371155	0.998	Nucleoporin p58/p45
7	9606.ENSP00000290158	0.997	Importin subunit beta-1
8	9606.ENSP00000444029	0.997	Nuclear pore complex protein Nup153
9	9606.ENSP00000285968	0.996	Nuclear pore complex protein Nup205
10	9606.ENSP00000436679	0.996	Nuclear RNA export factor 1
11	9606.ENSP00000283195	0.994	E3 SUMO-protein ligase RanBP2
12	9606.ENSP00000308622	0.994	Nucleoporin GLE1
13	9606.ENSP00000316032	0.994	Nuclear pore complex protein Nup98-Nup96
14	9606.ENSP00000231498	0.992	Nuclear pore complex protein Nup155
15	9606.ENSP00000384863	0.992	Exportin-1
16	9606.ENSP00000254508	0.984	Nuclear pore membrane glycoprotein 210
17	9606.ENSP00000361658	0.984	Nucleoporin NUP188 homolog
18	9606.ENSP00000229179	0.977	Nuclear pore complex protein Nup107
19	9606.ENSP00000401470	0.974	Ran GTPase-activating protein 1
20	9606.ENSP00000446215	0.967	GTP-binding nuclear protein Ran

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019904	0.995	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051649	0.989	establishment of localization in cell
GO:0050794	0.985	regulation of cellular process
GO:0007049	0.984	cell cycle
GO:0080090	0.968	regulation of primary metabolic process
GO:0000278	0.965	mitotic cell cycle
GO:0048522	0.962	positive regulation of cellular process
GO:0051171	0.938	regulation of nitrogen compound metabolic process
GO:0060255	0.937	regulation of macromolecule metabolic process
GO:0071840	0.922	cellular component organization or biogenesis
GO:0046907	0.908	intracellular transport
GO:0008152	0.901	metabolic process
GO:0032879	0.892	regulation of localization
GO:0006913	0.890	nucleocytoplasmic transport
GO:0050896	0.887	response to stimulus
GO:0016043	0.886	cellular component organization
GO:0031323	0.880	regulation of cellular metabolic process
GO:0033036	0.868	macromolecule localization
GO:0042306	0.862	regulation of protein import into nucleus
GO:0006886	0.846	intracellular protein transport
GO:0033365	0.838	protein localization to organelle
GO:0048519	0.835	negative regulation of biological process
GO:0051716	0.825	cellular response to stimulus
GO:0048523	0.816	negative regulation of cellular process
GO:0032502	0.808	developmental process
GO:0071704	0.785	organic substance metabolic process
GO:0034504	0.778	protein localization to nucleus
GO:0006996	0.777	organelle organization
GO:0051170	0.761	import into nucleus
GO:0006606	0.751	protein import into nucleus
GO:0051726	0.740	regulation of cell cycle
GO:0044237	0.699	cellular metabolic process
GO:0009966	0.687	regulation of signal transduction
GO:0051640	0.681	organelle localization
GO:0032501	0.637	multicellular organismal process
GO:0051128	0.630	regulation of cellular component organization
GO:0010647	0.617	positive regulation of cell communication
GO:1902531	0.615	regulation of intracellular signal transduction
GO:0000003	0.612	reproduction
GO:0022402	0.612	cell cycle process
GO:1903047	0.601	mitotic cell cycle process
GO:0043170	0.587	macromolecule metabolic process
GO:0065009	0.584	regulation of molecular function
GO:0010564	0.524	regulation of cell cycle process
GO:0042127	0.502	regulation of cell population proliferation
GO:0033043	0.501	regulation of organelle organization
GO:0048584	0.495	positive regulation of response to stimulus
GO:0023056	0.488	positive regulation of signaling
GO:0051246	0.484	regulation of protein metabolic process
GO:0010605	0.484	negative regulation of macromolecule metabolic process
GO:0044238	0.480	primary metabolic process
GO:0050790	0.477	regulation of catalytic activity
GO:0032886	0.457	regulation of microtubule-based process
GO:0006807	0.452	nitrogen compound metabolic process
GO:0051656	0.405	establishment of organelle localization
GO:0010468	0.367	regulation of gene expression
GO:0031324	0.358	negative regulation of cellular metabolic process
GO:0051172	0.337	negative regulation of nitrogen compound metabolic process
GO:0009967	0.337	positive regulation of signal transduction
GO:0051174	0.326	regulation of phosphorus metabolic process
GO:0019219	0.310	regulation of nucleobase-containing compound metabolic process
GO:0031399	0.306	regulation of protein modification process
GO:0044085	0.303	cellular component biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031965	0.999	nuclear membrane
GO:0005654	0.998	nucleoplasm
GO:0032991	0.987	protein-containing complex
GO:0005829	0.964	cytosol
GO:0140513	0.893	nuclear protein-containing complex
GO:0005643	0.572	nuclear pore
GO:0043232	0.353	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]