StarFunc result for job id P37231

User Input

>input (505 residues)
MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDLSVMEDHSHSF
DIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKT
QLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNC
RIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLR
ALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQE
QSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLAS
LMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII
LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQL
LQVIKKTETDMSLHPLLQEIYKDLY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O88275	0.753	0.753	2.427E-61	505	0.958	0.958	O88275.pdb.gz	PPARG_RAT Peroxisome proliferator-activated receptor gamma OS=Rattus norvegicus OX=10116 GN=Pparg PE=1 SV=2
2	AFDB:Q03181	0.742	0.847	1.344E-41	441	0.505	0.578	Q03181.pdb.gz	PPARD_HUMAN Peroxisome proliferator-activated receptor delta OS=Homo sapiens OX=9606 GN=PPARD PE=1 SV=1
3	AFDB:F1D8S4	0.711	0.766	8.111E-41	468	0.529	0.571	F1D8S4.pdb.gz	F1D8S4_HUMAN Peroxisome proliferator-activated receptor alpha OS=Homo sapiens OX=9606 GN=NR1C1 PE=2 SV=1
4	AFDB:Q9I8W4	0.710	0.765	1.010E-40	468	0.511	0.551	Q9I8W4.pdb.gz	Q9I8W4_CHICK Peroxisome proliferator-activated receptor alpha OS=Gallus gallus OX=9031 GN=PPARalpha PE=2 SV=1
5	AFDB:F8W3D2	0.720	0.733	2.080E-39	496	0.499	0.508	F8W3D2.pdb.gz	F8W3D2_DANRE Peroxisome proliferator-activated receptor delta OS=Danio rerio OX=7955 GN=pparda PE=3 SV=1
6	AFDB:A6XMH7	0.555	0.606	7.415E-39	459	0.511	0.562	A6XMH7.pdb.gz	A6XMH7_DANRE Peroxisome proliferator-activated receptor alpha OS=Danio rerio OX=7955 GN=ppara PE=2 SV=1
7	AFDB:E2IH99	0.708	0.613	2.123E-38	587	0.558	0.480	E2IH99.pdb.gz	E2IH99_ONCMY Peroxisome proliferator-activated receptor gamma OS=Oncorhynchus mykiss OX=8022 GN=PPARg PE=2 SV=1
8	AFDB:F1QJT0	0.530	0.566	4.675E-38	472	0.479	0.513	F1QJT0.pdb.gz
9	AFDB:B4DXU5	0.415	0.461	2.377E-20	453	0.236	0.263	B4DXU5.pdb.gz	B4DXU5_HUMAN Nuclear receptor subfamily 1 group H member 3 OS=Homo sapiens OX=9606 GN=NR1H3 PE=1 SV=1
10	AFDB:A0A0R4IVP0	0.412	0.470	3.685E-20	441	0.226	0.259	A0A0R4IVP0.pdb.gz	A0A0R4IVP0_DANRE Nuclear receptor subfamily 1, group H, member 3 OS=Danio rerio OX=7955 GN=im:7141239 PE=3 SV=1
11	PDB:3dzyA	0.345	0.561	1.050E-14	302	0.200	0.334	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
12	PDB:6fx0A	0.424	0.866	6.180E-11	238	0.121	0.256	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
13	PDB:1g2nA	0.342	0.666	4.831E-6	246	0.083	0.171	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
14	PDB:7kw7F	0.343	0.634	6.705E-5	259	0.079	0.154	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
15	PDB:1keyB	0.106	0.140	2.331E-1	221	0.069	0.158	1keyB.pdb.gz
16	PDB:3c98B	0.089	0.146	3.945E-1	230	0.061	0.135	3c98B.pdb.gz
17	PDB:2noxB	0.095	0.126	4.702E-1	266	0.077	0.147	2noxB.pdb.gz	Crystal structure and mechanism of tryptophan 2,3-dioxygenase, a heme enzyme involved in tryptophan catabolism and in quinolinate biosynthesis.
18	PDB:1wmwA	0.117	0.162	5.603E-1	328	0.059	0.091	1wmwA.pdb.gz
19	PDB:7sqcC2	0.089	0.045	7.615E-1	1498	0.093	0.031	7sqcC2.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
20	PDB:4abnB	0.082	0.093	9.075E-1	426	0.077	0.092	4abnB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A494C012	0.0	592	293	0.580	1.000	A0A494C012_HUMAN Peroxisome proliferator-activated receptor gamma OS=Homo sapiens OX=9606 GN=PPARG PE=1 SV=1
2	A0A494C0D9	0.0	793	376	0.745	1.000	A0A494C0D9_HUMAN Peroxisome proliferator-activated receptor gamma (Fragment) OS=Homo sapiens OX=9606 GN=PPARG PE=1 SV=1
3	A0A494C0T3	0.0	768	371	0.735	1.000	A0A494C0T3_HUMAN Peroxisome proliferator-activated receptor gamma OS=Homo sapiens OX=9606 GN=PPARG PE=1 SV=1
4	A6XMH6	0.0	665	527	0.650	0.622	A6XMH6_DANRE Peroxisome proliferator-activated receptor gamma OS=Danio rerio OX=7955 GN=PPAR[g] PE=2 SV=1
5	E2IH99	0.0	545	587	0.527	0.453	E2IH99_ONCMY Peroxisome proliferator-activated receptor gamma OS=Oncorhynchus mykiss OX=8022 GN=PPARg PE=2 SV=1
6	E9PFV2	0.0	988	475	0.941	1.000	E9PFV2_HUMAN Peroxisome proliferator-activated receptor gamma OS=Homo sapiens OX=9606 GN=PPARG PE=1 SV=2
7	E9PFX5	0.0	519	248	0.481	0.980	E9PFX5_HUMAN Peroxisome proliferator-activated receptor gamma OS=Homo sapiens OX=9606 GN=PPARG PE=1 SV=2
8	F1D8S4	0.0	529	468	0.497	0.536	F1D8S4_HUMAN Peroxisome proliferator-activated receptor alpha OS=Homo sapiens OX=9606 GN=NR1C1 PE=2 SV=1
9	O62807	0.0	1024	504	0.978	0.980	PPARG_PIG Peroxisome proliferator-activated receptor gamma OS=Sus scrofa OX=9823 GN=PPARG PE=2 SV=1
10	O88275	0.0	1013	505	0.958	0.958	PPARG_RAT Peroxisome proliferator-activated receptor gamma OS=Rattus norvegicus OX=10116 GN=Pparg PE=1 SV=2
11	P23204	0.0	526	468	0.485	0.524	PPARA_MOUSE Peroxisome proliferator-activated receptor alpha OS=Mus musculus OX=10090 GN=Ppara PE=1 SV=2
12	P35396	0.0	525	440	0.479	0.550	PPARD_MOUSE Peroxisome proliferator-activated receptor delta OS=Mus musculus OX=10090 GN=Ppard PE=1 SV=1
13	P37230	0.0	528	468	0.491	0.530	PPARA_RAT Peroxisome proliferator-activated receptor alpha OS=Rattus norvegicus OX=10116 GN=Ppara PE=1 SV=1
14	P37231	0.0	1049	505	1.000	1.000	PPARG_HUMAN Peroxisome proliferator-activated receptor gamma OS=Homo sapiens OX=9606 GN=PPARG PE=1 SV=3
15	P37238	0.0	1016	505	0.960	0.960	PPARG_MOUSE Peroxisome proliferator-activated receptor gamma OS=Mus musculus OX=10090 GN=Pparg PE=1 SV=3
16	Q03181	0.0	533	441	0.483	0.553	PPARD_HUMAN Peroxisome proliferator-activated receptor delta OS=Homo sapiens OX=9606 GN=PPARD PE=1 SV=1
17	Q07869	0.0	529	468	0.497	0.536	PPARA_HUMAN Peroxisome proliferator-activated receptor alpha OS=Homo sapiens OX=9606 GN=PPARA PE=1 SV=2
18	Q9I8W4	0.0	531	468	0.503	0.543	Q9I8W4_CHICK Peroxisome proliferator-activated receptor alpha OS=Gallus gallus OX=9031 GN=PPARalpha PE=2 SV=1
19	Q9MZG4	0.0	525	441	0.479	0.549	Q9MZG4_PIG Peroxisome proliferator activated receptor beta (Fragment) OS=Sus scrofa OX=9823 GN=PPARbeta PE=2 SV=1
20	F8W3D2	4.56e-180	516	496	0.485	0.494	F8W3D2_DANRE Peroxisome proliferator-activated receptor delta OS=Danio rerio OX=7955 GN=pparda PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00104 Hormone_recep	4.7e-12	57.5	Ligand-binding domain of nuclear hormone receptor
2	PF12577 PPARgamma_N	1.3e-29	114.0	PPAR gamma N-terminal region
3	PF09788 Tmemb_55A	65	14.1	Transmembrane protein 55A
4	PF00105 zf-C4	6.6e-24	95.5	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000287820

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262367	0.999	CREB-binding protein
2	9606.ENSP00000263253	0.999	Histone acetyltransferase p300
3	9606.ENSP00000264867	0.999	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
4	9606.ENSP00000268712	0.999	Nuclear receptor corepressor 1
5	9606.ENSP00000300651	0.999	Mediator of RNA polymerase II transcription subunit 1
6	9606.ENSP00000384018	0.999	Nuclear receptor corepressor 2
7	9606.ENSP00000384273	0.999	Transcription factor p65
8	9606.ENSP00000385216	0.999	Nuclear receptor coactivator 1
9	9606.ENSP00000399968	0.999	Nuclear receptor coactivator 2
10	9606.ENSP00000212015	0.998	NAD-dependent protein deacetylase sirtuin-1
11	9606.ENSP00000419692	0.998	Retinoic acid receptor RXR-alpha
12	9606.ENSP00000302967	0.997	Histone deacetylase 3
13	9606.ENSP00000305422	0.997	CCAAT/enhancer-binding protein beta
14	9606.ENSP00000344456	0.997	Catenin beta-1
15	9606.ENSP00000256104	0.995	Fatty acid-binding protein, adipocyte
16	9606.ENSP00000427514	0.995	CCAAT/enhancer-binding protein alpha
17	9606.ENSP00000271640	0.993	Histone-lysine N-methyltransferase SETDB1
18	9606.ENSP00000386660	0.993	Lysine-specific demethylase 3A
19	9606.ENSP00000270722	0.990	PR domain zinc finger protein 16
20	9606.ENSP00000389814	0.989	Adiponectin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0038023	0.998	signaling receptor activity
GO:1990837	0.997	sequence-specific double-stranded DNA binding
GO:0004879	0.991	nuclear receptor activity
GO:0001067	0.959	transcription regulatory region nucleic acid binding
GO:0000976	0.954	transcription cis-regulatory region binding
GO:0061629	0.948	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0001221	0.896	transcription coregulator binding
GO:0016922	0.849	nuclear receptor binding
GO:0019899	0.709	enzyme binding
GO:0019902	0.388	phosphatase binding
GO:0019903	0.365	protein phosphatase binding
GO:0001223	0.314	transcription coactivator binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048518	0.998	positive regulation of biological process
GO:0080090	0.998	regulation of primary metabolic process
GO:0051171	0.998	regulation of nitrogen compound metabolic process
GO:0010468	0.996	regulation of gene expression
GO:0031326	0.996	regulation of cellular biosynthetic process
GO:0050896	0.994	response to stimulus
GO:0009987	0.993	cellular process
GO:0006355	0.992	regulation of DNA-templated transcription
GO:0048519	0.988	negative regulation of biological process
GO:0048522	0.985	positive regulation of cellular process
GO:0051716	0.982	cellular response to stimulus
GO:0009893	0.979	positive regulation of metabolic process
GO:0010604	0.970	positive regulation of macromolecule metabolic process
GO:0051173	0.956	positive regulation of nitrogen compound metabolic process
GO:0031325	0.951	positive regulation of cellular metabolic process
GO:0009891	0.949	positive regulation of biosynthetic process
GO:0006357	0.946	regulation of transcription by RNA polymerase II
GO:0045893	0.938	positive regulation of DNA-templated transcription
GO:0045944	0.905	positive regulation of transcription by RNA polymerase II
GO:0009892	0.769	negative regulation of metabolic process
GO:0071704	0.746	organic substance metabolic process
GO:0023052	0.673	signaling
GO:1905952	0.668	regulation of lipid localization
GO:0032502	0.654	developmental process
GO:0044238	0.649	primary metabolic process
GO:0007165	0.646	signal transduction
GO:0032501	0.601	multicellular organismal process
GO:0048856	0.578	anatomical structure development
GO:0042221	0.572	response to chemical
GO:0044237	0.562	cellular metabolic process
GO:0006807	0.526	nitrogen compound metabolic process
GO:0048523	0.525	negative regulation of cellular process
GO:0048583	0.475	regulation of response to stimulus
GO:0023051	0.427	regulation of signaling
GO:0010646	0.427	regulation of cell communication
GO:0051049	0.415	regulation of transport
GO:0010605	0.408	negative regulation of macromolecule metabolic process
GO:0043170	0.406	macromolecule metabolic process
GO:0009966	0.384	regulation of signal transduction
GO:0070887	0.348	cellular response to chemical stimulus
GO:0010033	0.337	response to organic substance
GO:0051239	0.333	regulation of multicellular organismal process
GO:0006950	0.332	response to stress
GO:0065009	0.316	regulation of molecular function
GO:0009890	0.309	negative regulation of biosynthetic process
GO:0031324	0.307	negative regulation of cellular metabolic process
GO:0051172	0.306	negative regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005737	0.910	cytoplasm
GO:0005829	0.373	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]