StarFunc result for job id P37268

User Input

>input (417 residues)
MEFVKCLGHPEEFYNLVRFRIGGKRKVMPKMDQDSLSSSLKTCYKYLNQTSRSFAAVIQA
LDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQ
VLEDFPTISLEFRNLAEKYQTVIADICRRMGIGMAEFLDKHVTSEQEWDKYCHYVAGLVG
IGLSRLFSASEFEDPLVGEDTERANSMGLFLQKTNIIRDYLEDQQGGREFWPQEVWSRYV
KKLGDFAKPENIDLAVQCLNELITNALHHIPDVITYLSRLRNQSVFNFCAIPQVMAIATL
AACYNNQQVFKGAVKIRKGQAVTLMMDATNMPAVKAIIYQYMEEIYHRIPDSDPSSSKTR
QIISTIRTQNLPNCQLISRSHYSPIYLSFVMLLAALSWQYLTTLSQVTEDYVQTGEH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q02769	0.981	0.983	1.656E-47	416	0.859	0.861	Q02769.pdb.gz	FDFT_RAT Squalene synthase OS=Rattus norvegicus OX=10116 GN=Fdft1 PE=1 SV=1
2	AFDB:A0A1W2PQ47	0.814	0.713	3.182E-44	476	0.923	0.809	A0A1W2PQ47.pdb.gz	A0A1W2PQ47_HUMAN Squalene synthase OS=Homo sapiens OX=9606 GN=FDFT1 PE=1 SV=1
3	AFDB:A0A1P7Y0A2	0.866	0.870	3.547E-28	415	0.410	0.412	A0A1P7Y0A2.pdb.gz	SQS10_PANGI Squalene synthase 10 OS=Panax ginseng OX=4054 GN=SS10 PE=2 SV=1
4	AFDB:P53799	0.860	0.874	3.186E-27	410	0.408	0.415	P53799.pdb.gz	FDFT1_ARATH Squalene synthase 1 OS=Arabidopsis thaliana OX=3702 GN=SQS1 PE=1 SV=1
5	AFDB:D0VFU8	0.858	0.870	5.861E-27	411	0.415	0.421	D0VFU8.pdb.gz	SLSS_SOLLC Squalene synthase OS=Solanum lycopersicum OX=4081 GN=SS PE=1 SV=1
6	AFDB:Q9HGZ6	0.847	0.799	8.114E-27	443	0.415	0.391	Q9HGZ6.pdb.gz	FDFT_CANGA Squalene synthase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=ERG9 PE=3 SV=2
7	AFDB:A9XU48	0.872	0.883	1.218E-26	412	0.403	0.408	A9XU48.pdb.gz	A9XU48_GOSHI Squalene synthase OS=Gossypium hirsutum OX=3635 PE=2 SV=1
8	AFDB:A0A1D8PI71	0.858	0.800	1.376E-26	448	0.424	0.395	A0A1D8PI71.pdb.gz	ERG9_CANAL Squalene synthase ERG9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ERG9 PE=2 SV=1
9	AFDB:P36596	0.831	0.755	1.493E-26	460	0.410	0.372	P36596.pdb.gz	ERG9_SCHPO Squalene synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=erg9 PE=1 SV=1
10	AFDB:P29704	0.867	0.816	5.482E-26	444	0.424	0.399	P29704.pdb.gz	ERG9_YEAST Squalene synthase ERG9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ERG9 PE=1 SV=2
11	PDB:3ipiA	0.326	0.463	6.549E-3	268	0.118	0.183	3ipiA.pdb.gz
12	PDB:4gp2A	0.197	0.226	1.307E-2	342	0.137	0.167	4gp2A.pdb.gz	Crystal Structure of Isoprenoid Synthase from Pyrobaculum Calidifontis
13	PDB:3lvsB	0.259	0.349	4.998E-2	274	0.108	0.164	3lvsB.pdb.gz
14	PDB:3ucaA	0.286	0.394	6.919E-2	274	0.103	0.157	3ucaA.pdb.gz
15	PDB:6vkzA	0.333	0.325	6.919E-2	429	0.113	0.110	6vkzA.pdb.gz	Algal neurotoxin biosynthesis repurposes the terpene cyclase structural fold into anN-prenyltransferase.
16	PDB:2dh4A	0.220	0.261	7.505E-2	326	0.110	0.141	2dh4A.pdb.gz	Crystal Structure of Type-III Geranylgeranyl Pyrophosphate Synthase from Saccharomyces cerevisiae and the Mechanism of Product Chain Length Determination.
17	PDB:5ze6A	0.366	0.463	8.141E-2	315	0.084	0.111	5ze6A.pdb.gz	Discovery of Lipophilic Bisphosphonates That Target Bacterial Cell Wall and Quinone Biosynthesis.
18	PDB:5zlfA	0.336	0.450	1.498E-1	293	0.082	0.116	5zlfA.pdb.gz	Discovery of Lipophilic Bisphosphonates That Target Bacterial Cell Wall and Quinone Biosynthesis.
19	PDB:7p5cA	0.088	0.093	1.560E-1	392	0.127	0.135	7p5cA.pdb.gz
20	PDB:2azjA	0.287	0.391	1.912E-1	276	0.091	0.138	2azjA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1W2PQ47	0.0	805	476	0.923	0.809	A0A1W2PQ47_HUMAN Squalene synthase OS=Homo sapiens OX=9606 GN=FDFT1 PE=1 SV=1
2	E9PNM1	0.0	856	410	0.983	1.000	E9PNM1_HUMAN Squalene synthase OS=Homo sapiens OX=9606 GN=FDFT1 PE=1 SV=1
3	P37268	0.0	878	417	1.000	1.000	FDFT_HUMAN Squalene synthase OS=Homo sapiens OX=9606 GN=FDFT1 PE=1 SV=1
4	Q02769	0.0	771	416	0.854	0.856	FDFT_RAT Squalene synthase OS=Rattus norvegicus OX=10116 GN=Fdft1 PE=1 SV=1
5	Q6IAX1	0.0	878	417	1.000	1.000	Q6IAX1_HUMAN Squalene synthase OS=Homo sapiens OX=9606 GN=FDFT1 PE=2 SV=1
6	A0A1P7Y0A2	1.84e-110	332	415	0.417	0.419	SQS10_PANGI Squalene synthase 10 OS=Panax ginseng OX=4054 GN=SS10 PE=2 SV=1
7	A0A1P7Y0D4	5.87e-110	331	415	0.403	0.405	SQS11_PANGI Squalene synthase 11 OS=Panax ginseng OX=4054 GN=SS11 PE=2 SV=1
8	A0A1P7Y0D0	1.32e-109	330	415	0.405	0.407	SQS13_PANGI Squalene synthase 13 OS=Panax ginseng OX=4054 GN=SS13 PE=2 SV=1
9	A0A1P7Y0A8	1.70e-109	330	415	0.405	0.407	SQS12_PANGI Squalene synthase 12 OS=Panax ginseng OX=4054 GN=SS12 PE=2 SV=1
10	A0A1P7Y0C9	2.22e-109	329	391	0.398	0.425	SQS8_PANGI Squalene synthase 8 OS=Panax ginseng OX=4054 GN=SS8 PE=2 SV=1
11	P53799	2.72e-109	329	410	0.415	0.422	FDFT1_ARATH Squalene synthase 1 OS=Arabidopsis thaliana OX=3702 GN=SQS1 PE=1 SV=1
12	O48666	3.12e-109	329	415	0.408	0.410	SQS1_PANGI Squalene synthase 1 OS=Panax ginseng OX=4054 GN=SS1 PE=2 SV=1
13	E9PJG4	3.49e-108	317	150	0.360	1.000	E9PJG4_HUMAN Farnesyl-diphosphate farnesyltransferase 1 (Fragment) OS=Homo sapiens OX=9606 GN=FDFT1 PE=1 SV=1
14	P36596	1.28e-107	327	460	0.386	0.350	ERG9_SCHPO Squalene synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=erg9 PE=1 SV=1
15	A9XU48	4.73e-107	323	412	0.393	0.398	A9XU48_GOSHI Squalene synthase OS=Gossypium hirsutum OX=3635 PE=2 SV=1
16	D0VFU8	1.98e-106	322	411	0.408	0.414	SLSS_SOLLC Squalene synthase OS=Solanum lycopersicum OX=4081 GN=SS PE=1 SV=1
17	A0A144YEA5	4.93e-106	323	462	0.386	0.348	LSS_BOTBR Squalene synthase LSS OS=Botryococcus braunii OX=38881 GN=LSS PE=1 SV=1
18	A0A1D8PI71	2.05e-103	315	448	0.412	0.384	ERG9_CANAL Squalene synthase ERG9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ERG9 PE=2 SV=1
19	Q9HGZ6	1.16e-102	313	443	0.417	0.393	FDFT_CANGA Squalene synthase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=ERG9 PE=3 SV=2
20	P29704	2.86e-102	312	444	0.393	0.369	ERG9_YEAST Squalene synthase ERG9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ERG9 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02317 Octopine_DH	89	14.5	NAD/NADP octopine/nopaline dehydrogenase, alpha-helical domain
2	PF00494 SQS_PSY	4.8e-39	146.0	Squalene/phytoene synthase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000480828

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265896	0.997	Squalene monooxygenase
2	9606.ENSP00000349078	0.997	Farnesyl pyrophosphate synthase
3	9606.ENSP00000003100	0.995	Lanosterol 14-alpha demethylase
4	9606.ENSP00000261507	0.995	Methylsterol monooxygenase 1
5	9606.ENSP00000264027	0.994	Lathosterol oxidase
6	9606.ENSP00000282841	0.994	Geranylgeranyl pyrophosphate synthase
7	9606.ENSP00000359297	0.994	Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating
8	9606.ENSP00000380837	0.993	Lanosterol synthase
9	9606.ENSP00000370748	0.990	Isopentenyl-diphosphate Delta-isomerase 1
10	9606.ENSP00000254521	0.988	3-keto-steroid reductase
11	9606.ENSP00000354476	0.970	Sterol regulatory element-binding protein 2
12	9606.ENSP00000301012	0.968	Diphosphomevalonate decarboxylase
13	9606.ENSP00000348069	0.955	Sterol regulatory element-binding protein 1
14	9606.ENSP00000256319	0.949	Probable ergosterol biosynthetic protein 28
15	9606.ENSP00000322706	0.947	Hydroxymethylglutaryl-CoA synthase, cytoplasmic
16	9606.ENSP00000365388	0.944	Decaprenyl-diphosphate synthase subunit 1
17	9606.ENSP00000287936	0.933	3-hydroxy-3-methylglutaryl-coenzyme A reductase
18	9606.ENSP00000385523	0.929	Peroxisome proliferator-activated receptor alpha
19	9606.ENSP00000443551	0.928	Mevalonate kinase
20	9606.ENSP00000325690	0.923	Histone-arginine methyltransferase CARM1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004311	1.000	farnesyltranstransferase activity
GO:0005515	0.997	protein binding
GO:0004310	0.768	farnesyl-diphosphate farnesyltransferase activity
GO:0051996	0.712	squalene synthase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:0044238	0.999	primary metabolic process
GO:0008202	0.990	steroid metabolic process
GO:1901362	0.986	organic cyclic compound biosynthetic process
GO:0006694	0.984	steroid biosynthetic process
GO:0009987	0.882	cellular process
GO:0044237	0.688	cellular metabolic process
GO:1901615	0.530	organic hydroxy compound metabolic process
GO:0044281	0.401	small molecule metabolic process
GO:0044255	0.361	cellular lipid metabolic process
GO:0016125	0.345	sterol metabolic process
GO:0044283	0.340	small molecule biosynthetic process
GO:1901617	0.320	organic hydroxy compound biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0016020	0.953	membrane
GO:0005789	0.895	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:17653	1.000	(2E,6E)-farnesyl diphosphate + isopentenyl diphosphate = (2E,6E,10E)-geranylgeranyl diphosphate + diphosphate
EC:2.5.1.29	1.000	geranylgeranyl diphosphate synthase.
EC:2.5.1.21	0.768	squalene synthase.

[back to server]