StarFunc result for job id P37275

User Input

>input (1124 residues)
MADGPRCKRRKQANPRRNNVTNYNTVVETNSDSDDEDKLHIVEEESVTDAADCEGVPEDD
LPTDQTVLPGRSSEREGNAKNCWEDDRKEGQEILGPEAQADEAGCTVKDDECESDAENEQ
NHDPNVEEFLQQQDTAVIFPEAPEEDQRQGTPEASGHDENGTPDAFSQLLTCPYCDRGYK
RFTSLKEHIKYRHEKNEDNFSCSLCSYTFAYRTQLERHMTSHKSGRDQRHVTQSGCNRKF
KCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISLIPVNG
RPRTGLKTSQCSSPSLSASPGSPTRPQIRQKIENKPLQEQLSVNQIKTEPVDYEFKPIVV
ASGINCSTPLQNGVFTGGGPLQATSSPQGMVQAVVLPTVGLVSPISINLSDIQNVLKVAV
DGNVIRQVLENNQANLASKEQETINASPIQQGGHSVISAISLPLVDQDGTTKIIINYSLE
QPSQLQVVPQNLKKENPVATNSCKSEKLPEDLTVKSEKDKSFEGGVNDSTCLLCDDCPGD
INALPELKHYDLKQPTQPPPLPAAEAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYY
ALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNND
QPQSANANEPQDSTVNLQSPLKMTNSPVLPVGSTTNGSRSSTPSPSPLNLSSSRNTQGYL
YTAEGAQEEPQVEPLDLSLPKQQGELLERSTITSVYQNSVYSVQEEPLNLSCAKKEPQKD
SCVTDSEPVVNVIPPSANPINIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQ
VAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTE
NGMYACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICKKAFKHKHHLIEHMRLHSGEKPY
QCDKCGKRFSHSGSYSQHMNHRYSYCKREAEERDSTEQEEAGPEILSNEHVGARASPSQG
DSDERESLTREEDEDSEKEEEEEDKEMEELQEEKECEKPQGDEEEEEEEEEVEEEEVEEA
ENEGEEAKTEGLMKDDRAESQASSLGQKVGESSEQVSEEKTNEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P37275	0.999	0.999	0.000	1124	1.000	1.000	P37275.pdb.gz	ZEB1_HUMAN Zinc finger E-box-binding homeobox 1 OS=Homo sapiens OX=9606 GN=ZEB1 PE=1 SV=2
2	AFDB:A0A1B0GW50	0.197	0.186	9.263E-58	1202	0.425	0.398	A0A1B0GW50.pdb.gz	A0A1B0GW50_HUMAN Zinc finger E-box binding homeobox 2 OS=Homo sapiens OX=9606 GN=ZEB2 PE=1 SV=1
3	AFDB:F1QMZ5	0.198	0.189	1.276E-54	1190	0.457	0.432	F1QMZ5.pdb.gz	F1QMZ5_DANRE Zinc finger E-box-binding homeobox 1 isoform X1 OS=Danio rerio OX=7955 GN=zeb1a PE=4 SV=2
4	AFDB:Q5EXX3	0.083	0.079	1.044E-14	1203	0.157	0.147	Q5EXX3.pdb.gz	ZBT38_RAT Zinc finger and BTB domain-containing protein 38 OS=Rattus norvegicus OX=10116 GN=Zbtb38 PE=2 SV=1
5	AFDB:A2A7B5	0.058	0.047	3.404E-9	1709	0.166	0.109	A2A7B5.pdb.gz	A2A7B5_MOUSE PR domain containing 2, with ZNF domain OS=Mus musculus OX=10090 GN=Prdm2 PE=1 SV=1
6	AFDB:Q13029	0.062	0.047	4.085E-9	1718	0.171	0.112	Q13029.pdb.gz	PRDM2_HUMAN PR domain zinc finger protein 2 OS=Homo sapiens OX=9606 GN=PRDM2 PE=1 SV=3
7	AFDB:A0A1W2PQA1	0.051	0.052	4.613E-9	1069	0.133	0.140	A0A1W2PQA1.pdb.gz	A0A1W2PQA1_HUMAN RE1 silencing transcription factor OS=Homo sapiens OX=9606 GN=REST PE=1 SV=2
8	AFDB:P19538	0.058	0.049	2.853E-8	1397	0.146	0.117	P19538.pdb.gz	CI_DROME Transcriptional activator cubitus interruptus OS=Drosophila melanogaster OX=7227 GN=ci PE=1 SV=2
9	AFDB:F1M2B7	0.084	0.066	5.597E-7	1544	0.164	0.119	F1M2B7.pdb.gz	F1M2B7_RAT GLI family zinc finger 2 OS=Rattus norvegicus OX=10116 GN=Gli2 PE=3 SV=3
10	AFDB:Q5BIH1	0.069	0.094	6.716E-7	803	0.130	0.182	Q5BIH1.pdb.gz	Q5BIH1_DROME RE58581p OS=Drosophila melanogaster OX=7227 GN=klu PE=2 SV=1
11	PDB:3w5kB	0.037	0.252	3.764E-3	110	0.031	0.318	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:4egcA	0.040	0.084	7.845E-2	539	0.011	0.022	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
13	PDB:2hi3A	0.045	0.573	8.337E-2	73	0.012	0.192	2hi3A.pdb.gz
14	PDB:2cg4A	0.040	0.252	5.157E-1	149	0.012	0.087	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
15	PDB:5iplF	0.038	0.124	5.823E-1	277	0.012	0.051	5iplF.pdb.gz	Structures of E. coli sigma S-transcription initiation complexes provide new insights into polymerase mechanism.
16	PDB:2vbwA	0.040	0.262	6.575E-1	147	0.008	0.061	2vbwA.pdb.gz	Mechanistic Insights from the Crystal Structures of a Feast/Famine Regulatory Protein from Mycobacterium Tuberculosis H37Rv.
17	PDB:7fbyA	0.041	0.249	7.425E-1	153	0.008	0.059	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
18	PDB:3hrdD	0.035	0.212	1.448	160	0.008	0.056	3hrdD.pdb.gz	The Mo-Se active site of nicotinate dehydrogenase
19	PDB:3femA	0.036	0.131	2.216	281	0.008	0.032	3femA.pdb.gz
20	PDB:6hxgA	0.034	0.130	2.216	264	0.009	0.038	6hxgA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1B0GV02	0.0	759	1239	0.464	0.421	A0A1B0GV02_HUMAN Zinc finger E-box binding homeobox 2 OS=Homo sapiens OX=9606 GN=ZEB2 PE=1 SV=1
2	A0A1B0GVV8	0.0	706	1102	0.425	0.434	A0A1B0GVV8_HUMAN Zinc finger E-box binding homeobox 2 OS=Homo sapiens OX=9606 GN=ZEB2 PE=1 SV=1
3	A0A1B0GW50	0.0	748	1202	0.437	0.408	A0A1B0GW50_HUMAN Zinc finger E-box binding homeobox 2 OS=Homo sapiens OX=9606 GN=ZEB2 PE=1 SV=1
4	A0JP08	0.0	773	1213	0.464	0.430	A0JP08_HUMAN Zinc finger E-box binding homeobox 2 OS=Homo sapiens OX=9606 GN=ZEB2 PE=1 SV=1
5	B0LVE9	0.0	638	1201	0.433	0.405	B0LVE9_DANRE SIP1a OS=Danio rerio OX=7955 GN=si:dkey-52o2.2 PE=1 SV=1
6	B0LVF0	0.0	704	1219	0.422	0.389	B0LVF0_DANRE SIP1b OS=Danio rerio OX=7955 GN=zfhx1b PE=2 SV=1
7	B5DE38	0.0	572	1175	0.410	0.392	B5DE38_DANRE Zinc finger E-box-binding homeobox 2 isoform 2 OS=Danio rerio OX=7955 GN=wu:fc92g08 PE=1 SV=1
8	F1QY45	0.0	640	1218	0.431	0.398	F1QY45_DANRE Zinc finger E-box-binding homeobox 2 isoform X2 OS=Danio rerio OX=7955 GN=si:dkey-52o2.2 PE=1 SV=1
9	F6TDF5	0.0	610	289	0.255	0.993	F6TDF5_HUMAN Zinc finger E-box-binding homeobox 1 (Fragment) OS=Homo sapiens OX=9606 GN=ZEB1 PE=1 SV=1
10	O60315	0.0	773	1214	0.464	0.430	ZEB2_HUMAN Zinc finger E-box-binding homeobox 2 OS=Homo sapiens OX=9606 GN=ZEB2 PE=1 SV=1
11	P37275	0.0	2307	1124	1.000	1.000	ZEB1_HUMAN Zinc finger E-box-binding homeobox 1 OS=Homo sapiens OX=9606 GN=ZEB1 PE=1 SV=2
12	Q62947	0.0	1795	1109	0.859	0.870	ZEB1_RAT Zinc finger E-box-binding homeobox 1 OS=Rattus norvegicus OX=10116 GN=Zeb1 PE=1 SV=2
13	Q64318	0.0	1811	1117	0.827	0.832	ZEB1_MOUSE Zinc finger E-box-binding homeobox 1 OS=Mus musculus OX=10090 GN=Zeb1 PE=1 SV=1
14	Q9DEH7	0.0	1035	1078	0.542	0.565	Q9DEH7_DANRE Kheper OS=Danio rerio OX=7955 GN=kheper PE=1 SV=1
15	Q9R0G7	0.0	746	1215	0.449	0.416	ZEB2_MOUSE Zinc finger E-box-binding homeobox 2 OS=Mus musculus OX=10090 GN=Zeb2 PE=1 SV=2
16	U3KQ51	2.17e-169	526	955	0.343	0.404	U3KQ51_HUMAN Zinc finger E-box binding homeobox 2 OS=Homo sapiens OX=9606 GN=ZEB2 PE=1 SV=3
17	F1QMZ5	1.38e-118	397	1190	0.238	0.225	F1QMZ5_DANRE Zinc finger E-box-binding homeobox 1 isoform X1 OS=Danio rerio OX=7955 GN=zeb1a PE=4 SV=2
18	F1QBD3	1.14e-115	389	1176	0.223	0.213	F1QBD3_DANRE Zinc finger E-box-binding homeobox 1 isoform X2 OS=Danio rerio OX=7955 GN=zeb1a PE=4 SV=2
19	G5EBU4	8.45e-44	171	596	0.062	0.117	ZAG1_CAEEL Zinc finger E-box-binding homeobox protein zag-1 OS=Caenorhabditis elegans OX=6239 GN=zag-1 PE=2 SV=1
20	P28166	8.58e-38	156	1054	0.066	0.070	ZFH1_DROME Zinc finger protein 1 OS=Drosophila melanogaster OX=7227 GN=zfh1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00046 Homeodomain	0.11	23.7	Homeodomain
2	PF00096 zf-C2H2	1.8e-21	86.4	Zinc finger, C2H2 type
3	PF13894 zf-C2H2_4	4e-11	53.8	C2H2-type zinc finger
4	PF13912 zf-C2H2_6	24	16.3	C2H2-type zinc finger
5	PF12171 zf-C2H2_jaz	0.0013	30.2	Zinc-finger double-stranded RNA-binding
6	PF16278 zf-C2HE	1.2e+02	14.6	C2HE / C2H2 / C2HC zinc-binding finger
7	PF05605 zf-Di19	2.2e-05	36.0	Drought induced 19 protein (Di19), zinc-binding
8	PF13465 zf-H2C2_2	3.5e-23	92.1	Zinc-finger double domain
9	PF12874 zf-met	0.0002	32.8	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354487

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000290921	0.999	C-terminal-binding protein 1
2	9606.ENSP00000212015	0.992	NAD-dependent protein deacetylase sirtuin-1
3	9606.ENSP00000263253	0.990	Histone acetyltransferase p300
4	9606.ENSP00000395654	0.990	Transcription activator BRG1
5	9606.ENSP00000261769	0.988	Cadherin-1
6	9606.ENSP00000242261	0.986	Twist-related protein 1
7	9606.ENSP00000332973	0.986	Mothers against decapentaplegic homolog 3
8	9606.ENSP00000311825	0.985	C-terminal-binding protein 2
9	9606.ENSP00000323588	0.975	Transcription factor SOX-2
10	9606.ENSP00000479618	0.964	Myc proto-oncogene protein
11	9606.ENSP00000264657	0.962	Signal transducer and activator of transcription 3
12	9606.ENSP00000229307	0.960	Homeobox protein NANOG
13	9606.ENSP00000227507	0.959	G1/S-specific cyclin-D1
14	9606.ENSP00000306245	0.958	Proto-oncogene c-Fos
15	9606.ENSP00000437955	0.958	Hypoxia-inducible factor 1-alpha
16	9606.ENSP00000368880	0.931	Forkhead box protein O1
17	9606.ENSP00000385824	0.931	Forkhead box protein O3
18	9606.ENSP00000356840	0.926	POU domain, class 2, transcription factor 1
19	9606.ENSP00000343535	0.922	Ubiquitin carboxyl-terminal hydrolase 7
20	9606.ENSP00000301633	0.919	Baculoviral IAP repeat containing 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001227	1.000	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0046914	0.996	transition metal ion binding
GO:0008270	0.993	zinc ion binding
GO:1901363	0.951	heterocyclic compound binding
GO:0097159	0.949	organic cyclic compound binding
GO:0003676	0.933	nucleic acid binding
GO:0003677	0.919	DNA binding
GO:0000976	0.881	transcription cis-regulatory region binding
GO:0000977	0.873	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.820	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.786	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003682	0.744	chromatin binding
GO:0008134	0.741	transcription factor binding
GO:0001228	0.607	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0140297	0.514	DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048523	0.995	negative regulation of cellular process
GO:0006355	0.990	regulation of DNA-templated transcription
GO:0051253	0.965	negative regulation of RNA metabolic process
GO:0050793	0.962	regulation of developmental process
GO:0045892	0.957	negative regulation of DNA-templated transcription
GO:0006357	0.952	regulation of transcription by RNA polymerase II
GO:0051239	0.918	regulation of multicellular organismal process
GO:0000122	0.915	negative regulation of transcription by RNA polymerase II
GO:2000026	0.876	regulation of multicellular organismal development
GO:0048518	0.805	positive regulation of biological process
GO:0048522	0.794	positive regulation of cellular process
GO:0050896	0.745	response to stimulus
GO:0010604	0.727	positive regulation of macromolecule metabolic process
GO:0009987	0.687	cellular process
GO:0032502	0.638	developmental process
GO:0048856	0.624	anatomical structure development
GO:0032501	0.602	multicellular organismal process
GO:0051173	0.589	positive regulation of nitrogen compound metabolic process
GO:0031325	0.583	positive regulation of cellular metabolic process
GO:0051716	0.467	cellular response to stimulus
GO:0009891	0.446	positive regulation of biosynthetic process
GO:0010557	0.443	positive regulation of macromolecule biosynthetic process
GO:0045935	0.437	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.434	positive regulation of RNA metabolic process
GO:0045893	0.418	positive regulation of DNA-templated transcription
GO:0045595	0.417	regulation of cell differentiation
GO:0007275	0.395	multicellular organism development
GO:0045944	0.355	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005829	0.997	cytosol
GO:0032991	0.390	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]