StarFunc result for job id P37287

User Input

>input (484 residues)
MACRGGAGNGHRASATLSRVSPGSLYTCRTRTHNICMVSDFFYPNMGGVESHIYQLSQCL
IERGHKVIIVTHAYGNRKGIRYLTSGLKVYYLPLKVMYNQSTATTLFHSLPLLRYIFVRE
RVTIIHSHSSFSAMAHDALFHAKTMGLQTVFTDHSLFGFADVSSVLTNKLLTVSLCDTNH
IICVSYTSKENTVLRAALNPEIVSVIPNAVDPTDFTPDPFRRHDSITIVVVSRLVYRKGI
DLLSGIIPELCQKYPDLNFIIGGEGPKRIILEEVRERYQLHDRVRLLGALEHKDVRNVLV
QGHIFLNTSLTEAFCMAIVEAASCGLQVVSTRVGGIPEVLPENLIILCEPSVKSLCEGLE
KAIFQLKSGTLPAPENIHNIVKTFYTWRNVAERTEKVYDRVSVEAVLPMDKRLDRLISHC
GPVTGYIFALLAVFNFLFLIFLRWMTPDSIIDVAIDATGPRGAWTNNYSHSKRGGENNEI
SETR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P37287	1.000	1.000	5.765E-100	484	1.000	1.000	P37287.pdb.gz	PIGA_HUMAN Phosphatidylinositol N-acetylglucosaminyltransferase subunit A OS=Homo sapiens OX=9606 GN=PIGA PE=1 SV=1
2	AFDB:Q64323	0.947	0.945	1.288E-90	485	0.866	0.864	Q64323.pdb.gz	PIGA_MOUSE Phosphatidylinositol N-acetylglucosaminyltransferase subunit A OS=Mus musculus OX=10090 GN=Piga PE=2 SV=1
3	AFDB:Q94BX4	0.862	0.933	2.699E-62	447	0.481	0.521	Q94BX4.pdb.gz	PIGA_ARATH Phosphatidylinositol N-acetylglucosaminyltransferase subunit A OS=Arabidopsis thaliana OX=3702 GN=PIGA PE=2 SV=1
4	AFDB:Q585S5	0.864	0.918	3.395E-62	455	0.471	0.501	Q585S5.pdb.gz	Q585S5_TRYB2 phosphatidylinositol N-acetylglucosaminyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=27H14.50 PE=4 SV=1
5	AFDB:P32363	0.866	0.926	1.043E-57	452	0.405	0.434	P32363.pdb.gz	GPI3_YEAST Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPT14 PE=1 SV=4
6	AFDB:Q8IJ83	0.865	0.908	2.614E-57	461	0.415	0.436	Q8IJ83.pdb.gz	Q8IJ83_PLAF7 Phosphatidylinositol N-acetylglucosaminyltransferase subunit A, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1032400 PE=4 SV=2
7	AFDB:Q8NT41	0.648	0.751	1.876E-23	413	0.145	0.169	Q8NT41.pdb.gz	MGTA_CORGL GDP-mannose-dependent alpha-mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=mgtA PE=1 SV=1
8	AFDB:P9WMY7	0.681	0.687	2.787E-22	480	0.176	0.177	P9WMY7.pdb.gz	MSHA_MYCTU D-inositol 3-phosphate glycosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=mshA PE=1 SV=1
9	AFDB:P9WMY9	0.656	0.757	3.932E-22	414	0.165	0.193	P9WMY9.pdb.gz	GLGSY_MYCTU Glycogen synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3032 PE=1 SV=1
10	AFDB:Q8S4F6	0.645	0.614	6.982E-22	510	0.186	0.176	Q8S4F6.pdb.gz	SQD2_ARATH Sulfoquinovosyl transferase SQD2 OS=Arabidopsis thaliana OX=3702 GN=SQD2 PE=1 SV=1
11	PDB:3okaA	0.577	0.721	1.253E-19	378	0.161	0.206	3okaA.pdb.gz	Acceptor substrate discrimination in phosphatidyl-myo-inositol mannoside synthesis: structural and mutational analysis of mannosyltransferase Corynebacterium glutamicum PimB'.
12	PDB:3guhA	0.593	0.601	2.073E-17	477	0.155	0.157	3guhA.pdb.gz	The Crystal Structures of the Open and Catalytically Competent Closed Conformation of Escherichia coli Glycogen Synthase.
13	PDB:3s27H	0.628	0.401	7.764E-17	797	0.145	0.088	3s27H.pdb.gz	The Structure of Sucrose Synthase-1 from Arabidopsis thaliana and Its Functional Implications.
14	PDB:4nc9A	0.535	0.680	4.843E-15	369	0.163	0.214	4nc9A.pdb.gz
15	PDB:4pqgA	0.543	0.522	2.034E-14	506	0.130	0.125	4pqgA.pdb.gz	Structure of a Novel O-Linked N-Acetyl-d-glucosamine (O-GlcNAc) Transferase, GtfA, Reveals Insights into the Glycosylation of Pneumococcal Serine-rich Repeat Adhesins.
16	PDB:2wtxD	0.574	0.605	2.559E-14	457	0.112	0.118	2wtxD.pdb.gz	Mechanistic Insight Into Enzymatic Glycosyl Transfer with Retention of Configuration Through Analysis of Glycomimetic Inhibitors.
17	PDB:2iv7A	0.585	0.747	3.825E-14	370	0.120	0.157	2iv7A.pdb.gz	Insights Into the Synthesis of Lipopolysaccharide and Antibiotics Through the Structures of Two Retaining Glycosyltransferases from Family Gt4
18	PDB:5hutA	0.540	0.555	2.401E-13	469	0.112	0.115	5hutA.pdb.gz	Structural and In Vivo Studies on Trehalose-6-Phosphate Synthase from Pathogenic Fungi Provide Insights into Its Catalytic Mechanism, Biological Necessity, and Potential for Novel Antifungal Drug Design.
19	PDB:5hvoA	0.489	0.513	1.423E-12	459	0.107	0.113	5hvoA.pdb.gz	Structural and In Vivo Studies on Trehalose-6-Phosphate Synthase from Pathogenic Fungi Provide Insights into Its Catalytic Mechanism, Biological Necessity, and Potential for Novel Antifungal Drug Design.
20	PDB:5hvmB	0.556	0.592	3.566E-12	452	0.112	0.119	5hvmB.pdb.gz	Structural and In Vivo Studies on Trehalose-6-Phosphate Synthase from Pathogenic Fungi Provide Insights into Its Catalytic Mechanism, Biological Necessity, and Potential for Novel Antifungal Drug Design.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P37287	0.0	1000	484	1.000	1.000	PIGA_HUMAN Phosphatidylinositol N-acetylglucosaminyltransferase subunit A OS=Homo sapiens OX=9606 GN=PIGA PE=1 SV=1
2	Q64323	0.0	870	485	0.878	0.876	PIGA_MOUSE Phosphatidylinositol N-acetylglucosaminyltransferase subunit A OS=Mus musculus OX=10090 GN=Piga PE=2 SV=1
3	Q94BX4	1.13e-161	467	447	0.471	0.510	PIGA_ARATH Phosphatidylinositol N-acetylglucosaminyltransferase subunit A OS=Arabidopsis thaliana OX=3702 GN=PIGA PE=2 SV=1
4	Q585S5	6.94e-153	444	455	0.465	0.495	Q585S5_TRYB2 phosphatidylinositol N-acetylglucosaminyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=27H14.50 PE=4 SV=1
5	Q8IJ83	2.88e-133	395	461	0.403	0.423	Q8IJ83_PLAF7 Phosphatidylinositol N-acetylglucosaminyltransferase subunit A, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1032400 PE=4 SV=2
6	P32363	2.71e-130	387	452	0.405	0.434	GPI3_YEAST Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPT14 PE=1 SV=4
7	A0QWG6	6.33e-14	75.5	386	0.200	0.251	PIMA_MYCS2 Phosphatidyl-myo-inositol mannosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=pimA PE=1 SV=1
8	P9WMY9	1.98e-13	74.3	414	0.190	0.222	GLGSY_MYCTU Glycogen synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3032 PE=1 SV=1
9	A0R043	6.03e-10	63.2	382	0.159	0.202	PIMB_MYCS2 GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=pimB PE=1 SV=1
10	Q8NNK8	1.53e-09	62.0	381	0.107	0.136	PIMB_CORGL GDP-mannose-dependent monoacylated alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pimB PE=1 SV=1
11	A0A0H2URG7	2.30e-09	62.0	503	0.083	0.080	GTFA_STRPN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase GtfA subunit OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtfA PE=1 SV=1
12	Q93P60	3.60e-09	60.8	398	0.155	0.188	AMGDS_ACHLA Alpha-monoglucosyldiacylglycerol synthase OS=Acholeplasma laidlawii OX=2148 GN=mgs PE=1 SV=1
13	P71243	4.14e-09	60.8	406	0.095	0.113	WCAL_ECOLI Putative colanic acid biosynthesis glycosyltransferase WcaL OS=Escherichia coli (strain K12) OX=83333 GN=wcaL PE=3 SV=2
14	P9WMZ5	4.45e-09	60.5	378	0.178	0.228	PIMA_MYCTU Phosphatidyl-myo-inositol mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pimA PE=1 SV=1
15	Q3S2Y2	7.04e-09	60.5	506	0.099	0.095	GTFA_STRAG UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase GtfA subunit OS=Streptococcus agalactiae OX=1311 GN=gtfA PE=1 SV=1
16	A1C3L9	3.71e-08	58.2	504	0.091	0.087	GTFA_STRPA UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase GtfA subunit OS=Streptococcus parasanguinis OX=1318 GN=gtfA PE=1 SV=1
17	Q8NT41	9.01e-08	56.6	413	0.143	0.167	MGTA_CORGL GDP-mannose-dependent alpha-mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=mgtA PE=1 SV=1
18	Q65CC1	1.57e-07	55.8	387	0.091	0.114	KANF_STRKN 2-deoxystreptamine glucosyltransferase OS=Streptomyces kanamyceticus OX=1967 GN=kanF PE=1 SV=1
19	Q8S4F6	1.57e-07	56.2	510	0.066	0.063	SQD2_ARATH Sulfoquinovosyl transferase SQD2 OS=Arabidopsis thaliana OX=3702 GN=SQD2 PE=1 SV=1
20	X5KCU9	2.95e-07	55.1	444	0.165	0.180	X5KCU9_STRAG 1,2-diacylglycerol 3-glucosyltransferase OS=Streptococcus agalactiae OX=1311 GN=mgtA PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00534 Glycos_transf_1	1.2e-19	82.0	Glycosyl transferases group 1
2	PF13439 Glyco_transf_4	2.3e-21	88.1	Glycosyltransferase Family 4
3	PF08323 Glyco_transf_5	73	14.5	Starch synthase catalytic domain
4	PF13524 Glyco_trans_1_2	41	16.0	Glycosyl transferases group 1
5	PF13692 Glyco_trans_1_4	2e-17	75.2	Glycosyl transferases group 1
6	PF13579 Glyco_trans_4_4	1.3e-05	37.1	Glycosyl transferase 4-like domain
7	PF08288 PIGA	5.5e-39	144.0	PIGA (GPI anchor biosynthesis)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369820

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216452	0.999	Phosphatidylinositol N-acetylglucosaminyltransferase subunit H
2	9606.ENSP00000356702	0.998	Phosphatidylinositol N-acetylglucosaminyltransferase subunit C
3	9606.ENSP00000026218	0.995	Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q
4	9606.ENSP00000348888	0.991	Polymeric immunoglobulin receptor
5	9606.ENSP00000225609	0.990	N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase
6	9606.ENSP00000420037	0.987	Phosphatidylinositol N-acetylglucosaminyltransferase subunit P
7	9606.ENSP00000322181	0.981	Dolichol phosphate-mannose biosynthesis regulatory protein
8	9606.ENSP00000432688	0.956	Phosphatidylinositol N-acetylglucosaminyltransferase subunit Y
9	9606.ENSP00000357069	0.935	GPI mannosyltransferase 1
10	9606.ENSP00000273968	0.933	Protein preY, mitochondrial
11	9606.ENSP00000279036	0.907	GPI transamidase component PIG-T
12	9606.ENSP00000363260	0.898	GPI mannosyltransferase 2
13	9606.ENSP00000254801	0.890	Immunoglobulin J chain
14	9606.ENSP00000164305	0.884	GPI mannosyltransferase 3
15	9606.ENSP00000415203	0.870	GPI ethanolamine phosphate transferase 2
16	9606.ENSP00000281382	0.866	Phosphatidylinositol-glycan biosynthesis class F protein
17	9606.ENSP00000379191	0.860	CD59 glycoprotein
18	9606.ENSP00000350263	0.848	GPI ethanolamine phosphate transferase 1
19	9606.ENSP00000482202	0.842	Phosphatidylinositol-glycan biosynthesis class W protein
20	9606.ENSP00000219789	0.837	CDP-diacylglycerol--inositol 3-phosphatidyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0008375	0.998	acetylglucosaminyltransferase activity
GO:0017176	0.427	phosphatidylinositol N-acetylglucosaminyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0006807	0.996	nitrogen compound metabolic process
GO:1901576	0.996	organic substance biosynthetic process
GO:0043170	0.995	macromolecule metabolic process
GO:0044249	0.993	cellular biosynthetic process
GO:0044260	0.987	cellular macromolecule metabolic process
GO:0036211	0.985	protein modification process
GO:1901566	0.984	organonitrogen compound biosynthetic process
GO:0034645	0.979	cellular macromolecule biosynthetic process
GO:0046474	0.976	glycerophospholipid biosynthetic process
GO:1901137	0.975	carbohydrate derivative biosynthetic process
GO:0046488	0.975	phosphatidylinositol metabolic process
GO:0006506	0.973	GPI anchor biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	0.998	endoplasmic reticulum membrane
GO:0032991	0.995	protein-containing complex
GO:1902494	0.970	catalytic complex
GO:0098796	0.936	membrane protein complex
GO:1990234	0.868	transferase complex
GO:0140534	0.846	endoplasmic reticulum protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.
RHEA:14789	0.427	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + UDP-N-acetyl-alpha-D-glucosamine = a 6-(N-acetyl-alpha-D-glucosaminyl)-1-phosphatidyl-1D-myo-inositol + H(+) + UDP
EC:2.4.1.198	0.427	phosphatidylinositol N-acetylglucosaminyltransferase.

[back to server]