StarFunc result for job id P37840

User Input

>input (140 residues)
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK
EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDP
DNEAYEMPSEEGYQDYEPEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B5G014	0.325	0.319	1.852E-10	143	0.864	0.846	B5G014.pdb.gz	B5G014_TAEGU Alpha-synuclein OS=Taeniopygia guttata OX=59729 PE=2 SV=1
2	AFDB:Q9NZ50	0.529	0.574	9.582E-6	127	0.486	0.535	Q9NZ50.pdb.gz	SYUG_BOVIN Gamma-synuclein OS=Bos taurus OX=9913 GN=SNCG PE=1 SV=1
3	AFDB:O76070	0.613	0.670	1.552E-5	127	0.493	0.543	O76070.pdb.gz	SYUG_HUMAN Gamma-synuclein OS=Homo sapiens OX=9606 GN=SNCG PE=1 SV=2
4	AFDB:Q63544	0.354	0.400	1.360E-4	123	0.457	0.520	Q63544.pdb.gz	SYUG_RAT Gamma-synuclein OS=Rattus norvegicus OX=10116 GN=Sncg PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P37840	2.74e-94	270	140	1.000	1.000	SYUA_HUMAN Alpha-synuclein OS=Homo sapiens OX=9606 GN=SNCA PE=1 SV=1
2	P37377	8.96e-89	256	140	0.950	0.950	SYUA_RAT Alpha-synuclein OS=Rattus norvegicus OX=10116 GN=Snca PE=1 SV=1
3	O55042	2.33e-88	255	140	0.950	0.950	SYUA_MOUSE Alpha-synuclein OS=Mus musculus OX=10090 GN=Snca PE=1 SV=2
4	Q4JHT6	5.43e-77	226	143	0.879	0.860	Q4JHT6_TAEGU Alpha-synuclein OS=Taeniopygia guttata OX=59729 GN=SNCA PE=2 SV=1
5	B5G014	5.37e-75	221	143	0.864	0.846	B5G014_TAEGU Alpha-synuclein OS=Taeniopygia guttata OX=59729 PE=2 SV=1
6	B5G015	3.20e-70	209	143	0.836	0.818	B5G015_TAEGU Alpha-synuclein OS=Taeniopygia guttata OX=59729 PE=2 SV=1
7	Q63754	2.21e-38	128	137	0.557	0.569	SYUB_RAT Beta-synuclein OS=Rattus norvegicus OX=10116 GN=Sncb PE=1 SV=1
8	Q16143	3.33e-38	128	134	0.543	0.567	SYUB_HUMAN Beta-synuclein OS=Homo sapiens OX=9606 GN=SNCB PE=1 SV=1
9	Q7SX92	3.80e-36	122	127	0.571	0.630	Q7SX92_DANRE Beta-synuclein OS=Danio rerio OX=7955 GN=zgc:66343 PE=1 SV=1
10	Q91ZZ3	1.77e-35	121	133	0.543	0.571	SYUB_MOUSE Beta-synuclein OS=Mus musculus OX=10090 GN=Sncb PE=1 SV=1
11	Q9Z0F7	1.10e-33	116	123	0.471	0.537	SYUG_MOUSE Gamma-synuclein OS=Mus musculus OX=10090 GN=Sncg PE=1 SV=1
12	O76070	1.32e-33	116	127	0.493	0.543	SYUG_HUMAN Gamma-synuclein OS=Homo sapiens OX=9606 GN=SNCG PE=1 SV=2
13	Q6FHG5	1.32e-33	116	127	0.493	0.543	Q6FHG5_HUMAN Gamma-synuclein OS=Homo sapiens OX=9606 GN=SNCG PE=1 SV=1
14	Q9NZ50	1.40e-32	113	127	0.471	0.520	SYUG_BOVIN Gamma-synuclein OS=Bos taurus OX=9913 GN=SNCG PE=1 SV=1
15	Q502J6	8.35e-29	103	114	0.436	0.535	Q502J6_DANRE Gamma1a-synuclein OS=Danio rerio OX=7955 GN=sncg PE=1 SV=1
16	Q63544	2.97e-28	102	123	0.443	0.504	SYUG_RAT Gamma-synuclein OS=Rattus norvegicus OX=10116 GN=Sncg PE=1 SV=2
17	Q5THJ4	2.2	30.4	4388	0.193	0.006	VP13D_HUMAN Intermembrane lipid transfer protein VPS13D OS=Homo sapiens OX=9606 GN=VPS13D PE=1 SV=2
18	Q57V00	4.8	29.3	251	0.100	0.056	Q57V00_TRYB2 Kinetoplastid kinetochore protein 11 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.43M14.570 PE=4 SV=1
19	Q9HTK8	6.1	27.3	55	0.086	0.218	RUBR2_PSEAE Rubredoxin-2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=rubA2 PE=1 SV=1
20	A0A384MDN8	6.3	28.9	331	0.229	0.097	A0A384MDN8_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01387 Synuclein	1.6e-51	185.5	Synuclein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000338345

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261368	0.999	Synphilin-1
2	9606.ENSP00000270349	0.999	Sodium-dependent dopamine transporter
3	9606.ENSP00000302961	0.999	Heat shock protein family A member 4
4	9606.ENSP00000355865	0.999	E3 ubiquitin-protein ligase parkin
5	9606.ENSP00000353785	0.998	Tubulin polymerization-promoting protein
6	9606.ENSP00000418770	0.998	Protein/nucleic acid deglycase DJ-1
7	9606.ENSP00000314214	0.994	Vesicle-associated membrane protein 2
8	9606.ENSP00000370571	0.992	Tyrosine 3-monooxygenase
9	9606.ENSP00000432083	0.992	Heat shock cognate 71 kDa protein
10	9606.ENSP00000298910	0.989	Leucine-rich repeat serine/threonine-protein kinase 2
11	9606.ENSP00000340820	0.988	Microtubule-associated protein tau
12	9606.ENSP00000284981	0.987	Amyloid-beta A4 protein
13	9606.ENSP00000284440	0.984	Ubiquitin carboxyl-terminal hydrolase isozyme L1
14	9606.ENSP00000349156	0.984	E3 ubiquitin-protein ligase SIAH1
15	9606.ENSP00000346671	0.983	Tyrosine-protein kinase Fyn
16	9606.ENSP00000355566	0.980	Mitochondrial import receptor subunit TOM20 homolog
17	9606.ENSP00000219548	0.978	E3 ubiquitin-protein ligase CHIP
18	9606.ENSP00000481029	0.977	26S proteasome regulatory subunit 6A
19	9606.ENSP00000217244	0.974	Casein kinase II subunit alpha
20	9606.ENSP00000378217	0.971	Protein kinase C delta type

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008289	0.481	lipid binding
GO:0015631	0.396	tubulin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.996	regulation of cellular process
GO:0050896	0.995	response to stimulus
GO:0010941	0.994	regulation of cell death
GO:0042325	0.994	regulation of phosphorylation
GO:0031399	0.994	regulation of protein modification process
GO:0048523	0.993	negative regulation of cellular process
GO:0007610	0.991	behavior
GO:0048522	0.991	positive regulation of cellular process
GO:0008152	0.990	metabolic process
GO:0051179	0.989	localization
GO:0014070	0.989	response to organic cyclic compound
GO:0010646	0.989	regulation of cell communication
GO:0023051	0.988	regulation of signaling
GO:0051952	0.988	regulation of amine transport
GO:0065008	0.987	regulation of biological quality
GO:0009893	0.987	positive regulation of metabolic process
GO:0061900	0.987	glial cell activation
GO:0002269	0.987	leukocyte activation involved in inflammatory response
GO:1901700	0.986	response to oxygen-containing compound
GO:0023052	0.982	signaling
GO:0007154	0.982	cell communication
GO:1903530	0.982	regulation of secretion by cell
GO:0006810	0.979	transport
GO:0009892	0.979	negative regulation of metabolic process
GO:0044237	0.977	cellular metabolic process
GO:1901564	0.977	organonitrogen compound metabolic process
GO:0001932	0.973	regulation of protein phosphorylation
GO:0007267	0.969	cell-cell signaling
GO:0006584	0.969	catecholamine metabolic process
GO:0010243	0.968	response to organonitrogen compound
GO:0099504	0.968	synaptic vesicle cycle
GO:0051248	0.965	negative regulation of protein metabolic process
GO:0051050	0.964	positive regulation of transport
GO:0001505	0.963	regulation of neurotransmitter levels
GO:0043066	0.961	negative regulation of apoptotic process
GO:0014059	0.960	regulation of dopamine secretion
GO:0099537	0.958	trans-synaptic signaling
GO:0042326	0.957	negative regulation of phosphorylation
GO:0016043	0.955	cellular component organization
GO:0051716	0.954	cellular response to stimulus
GO:0031400	0.954	negative regulation of protein modification process
GO:0006897	0.953	endocytosis
GO:0007268	0.943	chemical synaptic transmission
GO:0043279	0.937	response to alkaloid
GO:0051247	0.937	positive regulation of protein metabolic process
GO:0009713	0.937	catechol-containing compound biosynthetic process
GO:0031325	0.935	positive regulation of cellular metabolic process
GO:0051588	0.932	regulation of neurotransmitter transport
GO:0030534	0.928	adult behavior
GO:1901215	0.926	negative regulation of neuron death
GO:0042417	0.921	dopamine metabolic process
GO:0042220	0.919	response to cocaine
GO:0050804	0.916	modulation of chemical synaptic transmission
GO:0070887	0.888	cellular response to chemical stimulus
GO:0032940	0.887	secretion by cell
GO:0032502	0.880	developmental process
GO:0009719	0.859	response to endogenous stimulus
GO:0071495	0.825	cellular response to endogenous stimulus
GO:0080134	0.820	regulation of response to stress
GO:0051239	0.809	regulation of multicellular organismal process
GO:0043523	0.791	regulation of neuron apoptotic process
GO:0044093	0.788	positive regulation of molecular function
GO:0034641	0.779	cellular nitrogen compound metabolic process
GO:0007165	0.777	signal transduction
GO:0009889	0.767	regulation of biosynthetic process
GO:0043933	0.754	protein-containing complex organization
GO:0043524	0.749	negative regulation of neuron apoptotic process
GO:0031326	0.743	regulation of cellular biosynthetic process
GO:0019219	0.743	regulation of nucleobase-containing compound metabolic process
GO:1901701	0.734	cellular response to oxygen-containing compound
GO:0022607	0.732	cellular component assembly
GO:0023056	0.724	positive regulation of signaling
GO:0009966	0.721	regulation of signal transduction
GO:0051128	0.718	regulation of cellular component organization
GO:0050790	0.717	regulation of catalytic activity
GO:0044238	0.688	primary metabolic process
GO:0010647	0.670	positive regulation of cell communication
GO:0071310	0.661	cellular response to organic substance
GO:0007626	0.641	locomotory behavior
GO:0048585	0.638	negative regulation of response to stimulus
GO:0010468	0.619	regulation of gene expression
GO:0044419	0.552	biological process involved in interspecies interaction between organisms
GO:0048856	0.546	anatomical structure development
GO:0043170	0.490	macromolecule metabolic process
GO:0019538	0.452	protein metabolic process
GO:0009894	0.440	regulation of catabolic process
GO:0010035	0.374	response to inorganic substance
GO:0006996	0.343	organelle organization
GO:1902531	0.326	regulation of intracellular signal transduction
GO:0033554	0.314	cellular response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.986	intracellular membrane-bounded organelle
GO:0030054	0.981	cell junction
GO:0016020	0.981	membrane
GO:0012505	0.979	endomembrane system
GO:0045202	0.973	synapse
GO:0071944	0.933	cell periphery
GO:0031410	0.869	cytoplasmic vesicle
GO:0043232	0.807	intracellular non-membrane-bounded organelle
GO:0005886	0.802	plasma membrane
GO:0031090	0.785	organelle membrane
GO:0005634	0.713	nucleus
GO:0032991	0.681	protein-containing complex
GO:0120025	0.621	plasma membrane bounded cell projection
GO:0043005	0.589	neuron projection
GO:0098588	0.581	bounding membrane of organelle
GO:0005739	0.510	mitochondrion
GO:0030659	0.490	cytoplasmic vesicle membrane
GO:0099503	0.481	secretory vesicle
GO:0031981	0.424	nuclear lumen
GO:0005654	0.396	nucleoplasm
GO:0043230	0.365	extracellular organelle
GO:0030424	0.329	axon

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]