StarFunc result for job id P38159

User Input

>input (391 residues)
MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPA
DAKDAARDMNGKSLDGKAIKVEQATKPSFESGRRGPPPPPRSRGPPRGLRGGRGGSGGTR
GPPSRGGHMDDGGYSMNFNMSSSRGPLPVKRGPPPRSGGPPPKRSAPSGPVRSSSGMGGR
APVSRGRDSYGGPPRREPLPSRRDVYLSPRDDGYSTKDSYSSRDYPSSRDTRDYAPPPRD
YTYRDYGHSSSRDDYPSRGYSDRDGYGRDRDYSDHPSGGSYRDSYESYGNSRSAPPTRGP
PPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSMERGYPPP
RDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P38159	0.999	0.999	1.385E-53	391	1.000	1.000	P38159.pdb.gz	RBMX_HUMAN RNA-binding motif protein, X chromosome OS=Homo sapiens OX=9606 GN=RBMX PE=1 SV=3
2	AFDB:A6NDE4	0.238	0.189	5.130E-28	496	0.619	0.488	A6NDE4.pdb.gz	RBY1B_HUMAN RNA-binding motif protein, Y chromosome, family 1 member B OS=Homo sapiens OX=9606 GN=RBMY1B PE=2 SV=2
3	AFDB:J3KPK3	0.251	0.217	5.468E-28	459	0.604	0.514	J3KPK3.pdb.gz	J3KPK3_HUMAN RNA binding motif protein Y-linked family 1 member E OS=Homo sapiens OX=9606 GN=RBMY1E PE=4 SV=1
4	AFDB:O35698	0.234	0.240	1.209E-23	380	0.463	0.476	O35698.pdb.gz	RBY1A_MOUSE RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Mus musculus OX=10090 GN=Rbmy1a1 PE=1 SV=2
5	AFDB:P48809	0.208	0.194	5.700E-11	421	0.202	0.188	P48809.pdb.gz	RB27C_DROME Heterogeneous nuclear ribonucleoprotein 27C OS=Drosophila melanogaster OX=7227 GN=Hrb27C PE=1 SV=2
6	AFDB:Q57WI8	0.224	0.258	6.475E-11	340	0.192	0.221	Q57WI8.pdb.gz	Q57WI8_TRYB2 RNA-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.28B13.110 PE=4 SV=1
7	AFDB:Q9LU44	0.203	0.104	8.905E-11	804	0.205	0.100	Q9LU44.pdb.gz	SF1_ARATH Splicing factor-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=SF1 PE=1 SV=1
8	AFDB:Q8RWN5	0.213	0.268	1.225E-10	310	0.235	0.297	Q8RWN5.pdb.gz	RZ1C_ARATH Glycine-rich RNA-binding protein RZ1C OS=Arabidopsis thaliana OX=3702 GN=RZ1C PE=1 SV=1
9	AFDB:Q9Y388	0.196	0.237	4.667E-10	322	0.176	0.214	Q9Y388.pdb.gz	RBMX2_HUMAN RNA-binding motif protein, X-linked 2 OS=Homo sapiens OX=9606 GN=RBMX2 PE=1 SV=2
10	PDB:7dvqY	0.200	0.547	5.527E-10	140	0.079	0.221	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
11	AFDB:Q8W569	0.228	0.198	6.419E-10	455	0.223	0.191	Q8W569.pdb.gz	Q8W569_ARATH AT4g26650/T15N24_100 OS=Arabidopsis thaliana OX=3702 GN=At4g26650 PE=1 SV=1
12	PDB:5yzg1	0.198	0.317	3.508E-9	243	0.084	0.136	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
13	PDB:6y53o	0.198	0.475	1.337E-8	160	0.072	0.175	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
14	PDB:6qx91K	0.206	0.393	1.619E-8	201	0.064	0.124	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
15	PDB:5gm6V	0.199	0.592	2.528E-8	128	0.066	0.203	5gm6V.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
16	PDB:5xjcw	0.195	0.818	2.872E-8	91	0.061	0.264	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
17	PDB:6gd1A	0.200	0.407	4.781E-8	190	0.066	0.137	6gd1A.pdb.gz
18	PDB:3lqvB	0.193	0.624	5.096E-8	115	0.054	0.183	3lqvB.pdb.gz	Branch Recognition by SF3b14
19	PDB:6n7pA	0.196	0.405	7.008E-8	186	0.064	0.134	6n7pA.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
20	PDB:1hl6A	0.195	0.631	1.604E-7	119	0.061	0.202	1hl6A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P38159	0.0	723	391	1.000	1.000	RBMX_HUMAN RNA-binding motif protein, X chromosome OS=Homo sapiens OX=9606 GN=RBMX PE=1 SV=3
2	P84586	0.0	700	388	0.972	0.979	RMXRL_RAT RNA-binding motif protein, X chromosome retrogene-like OS=Rattus norvegicus OX=10116 GN=Rbmxrtl PE=1 SV=1
3	Q4V898	0.0	706	390	0.982	0.985	RBMX_RAT RNA-binding motif protein, X chromosome OS=Rattus norvegicus OX=10116 GN=Rbmx PE=1 SV=1
4	Q91VM5	0.0	702	388	0.977	0.985	RMXL1_MOUSE RNA binding motif protein, X-linked-like-1 OS=Mus musculus OX=10090 GN=Rbmxl1 PE=2 SV=1
5	J3KQ82	8.68e-121	359	459	0.601	0.512	J3KQ82_HUMAN RNA binding motif protein Y-linked family 1 member F OS=Homo sapiens OX=9606 GN=RBMY1F PE=4 SV=1
6	J3KPK3	5.38e-120	357	459	0.598	0.510	J3KPK3_HUMAN RNA binding motif protein Y-linked family 1 member E OS=Homo sapiens OX=9606 GN=RBMY1E PE=4 SV=1
7	P0C7P1	6.95e-104	317	496	0.491	0.387	RBY1D_HUMAN RNA-binding motif protein, Y chromosome, family 1 member D OS=Homo sapiens OX=9606 GN=RBMY1D PE=2 SV=1
8	Q15415	7.02e-104	317	496	0.491	0.387	RBY1F_HUMAN RNA-binding motif protein, Y chromosome, family 1 member F/J OS=Homo sapiens OX=9606 GN=RBMY1F PE=1 SV=2
9	A6NDE4	8.53e-104	317	496	0.491	0.387	RBY1B_HUMAN RNA-binding motif protein, Y chromosome, family 1 member B OS=Homo sapiens OX=9606 GN=RBMY1B PE=2 SV=2
10	A6NEQ0	8.53e-104	317	496	0.491	0.387	RBY1E_HUMAN RNA-binding motif protein, Y chromosome, family 1 member E OS=Homo sapiens OX=9606 GN=RBMY1E PE=1 SV=1
11	P0DJD4	9.20e-104	317	496	0.491	0.387	RBY1C_HUMAN RNA-binding motif protein, Y chromosome, family 1 member C OS=Homo sapiens OX=9606 GN=RBMY1C PE=1 SV=1
12	P0DJD3	9.60e-104	317	496	0.491	0.387	RBY1A_HUMAN RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Homo sapiens OX=9606 GN=RBMY1A1 PE=1 SV=1
13	O35698	3.86e-89	276	380	0.445	0.458	RBY1A_MOUSE RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Mus musculus OX=10090 GN=Rbmy1a1 PE=1 SV=2
14	P60824	5.59e-31	118	172	0.138	0.314	CIRBP_MOUSE Cold-inducible RNA-binding protein OS=Mus musculus OX=10090 GN=Cirbp PE=1 SV=1
15	P60825	5.59e-31	118	172	0.138	0.314	CIRBP_RAT Cold-inducible RNA-binding protein OS=Rattus norvegicus OX=10116 GN=Cirbp PE=2 SV=1
16	Q9DED4	9.19e-31	117	166	0.136	0.319	CIRBB_XENLA Cold-inducible RNA-binding protein B OS=Xenopus laevis OX=8355 GN=cirbp-b PE=1 SV=1
17	K7EPM4	1.18e-30	117	168	0.136	0.315	K7EPM4_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens OX=9606 GN=CIRBP PE=1 SV=1
18	Q14011	1.38e-30	117	172	0.136	0.308	CIRBP_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens OX=9606 GN=CIRBP PE=1 SV=1
19	Q53XX5	1.38e-30	117	172	0.136	0.308	Q53XX5_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens OX=9606 GN=CIRBP PE=2 SV=1
20	K7EMY9	1.45e-30	116	159	0.136	0.333	K7EMY9_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens OX=9606 GN=CIRBP PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14703 PHM7_cyt	7.1e+02	11.8	Cytosolic domain of 10TM putative phosphate transporter
2	PF08081 RBM1CTR	1.5e-19	81.0	RBM1CTR (NUC064) family
3	PF00076 RRM_1	1.1e-19	81.3	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
4	PF13893 RRM_5	1.2e+02	13.8	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
5	PF16367 RRM_7	4.9	18.7	RNA recognition motif
6	PF16842 RRM_occluded	1.6e+02	13.6	Occluded RNA-recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008583669.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008567267.1	0.943	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 15 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments
2	482537.XP_008582146.1	0.891	Heterogeneous nuclear ribonucleoprotein M isoform X1
3	482537.XP_008590793.1	0.888	Double-stranded RNA-specific adenosine deaminase isoform X1
4	482537.XP_008578388.1	0.868	Regulator of nonsense transcripts 1
5	482537.XP_008588342.1	0.849	Heterogeneous nuclear ribonucleoprotein U isoform X1
6	482537.XP_008574423.1	0.842	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
7	482537.XP_008572294.1	0.784	Heterogeneous nuclear ribonucleoproteins C1/C2
8	482537.XP_008563825.1	0.760	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 5 bases in 3 codons
9	482537.XP_008576098.1	0.753	Transformer-2 protein homolog beta isoform X1
10	482537.XP_008571686.1	0.751	Heterogeneous nuclear ribonucleoprotein A3 isoform X1
11	482537.XP_008590365.1	0.736	Polypyrimidine tract-binding protein 1 isoform X1
12	482537.XP_008586179.1	0.734	Heterogeneous nuclear ribonucleoprotein C
13	482537.XP_008571050.1	0.729	Heterogeneous nuclear ribonucleoprotein R isoform X1
14	482537.XP_008561413.1	0.722	Heterogeneous nuclear ribonucleoprotein F
15	482537.XP_008562834.1	0.722	Heterogeneous nuclear ribonucleoprotein C-like
16	482537.XP_008572155.1	0.717	Heterogeneous nuclear ribonucleoprotein L isoform X1
17	482537.XP_008589522.1	0.705	Heterogeneous nuclear ribonucleoprotein A1-like
18	482537.XP_008586704.1	0.695	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 15 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
19	482537.XP_008573654.1	0.691	Heterogeneous nuclear ribonucleoprotein A0
20	482537.XP_008579541.1	0.674	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003677	0.994	DNA binding
GO:0003729	0.993	mRNA binding
GO:0042802	0.989	identical protein binding
GO:0000978	0.905	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003682	0.902	chromatin binding
GO:0019904	0.894	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019222	0.995	regulation of metabolic process
GO:0044238	0.993	primary metabolic process
GO:0044237	0.993	cellular metabolic process
GO:0071704	0.992	organic substance metabolic process
GO:0050794	0.992	regulation of cellular process
GO:0080090	0.992	regulation of primary metabolic process
GO:0051171	0.992	regulation of nitrogen compound metabolic process
GO:0060255	0.989	regulation of macromolecule metabolic process
GO:0006807	0.984	nitrogen compound metabolic process
GO:0031323	0.979	regulation of cellular metabolic process
GO:0010468	0.973	regulation of gene expression
GO:0016070	0.970	RNA metabolic process
GO:0016071	0.958	mRNA metabolic process
GO:0008380	0.950	RNA splicing
GO:0019219	0.947	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.928	regulation of RNA metabolic process
GO:0006397	0.927	mRNA processing
GO:0048518	0.921	positive regulation of biological process
GO:0048522	0.876	positive regulation of cellular process
GO:0048519	0.873	negative regulation of biological process
GO:0010604	0.867	positive regulation of macromolecule metabolic process
GO:1903311	0.857	regulation of mRNA metabolic process
GO:0010556	0.849	regulation of macromolecule biosynthetic process
GO:0043484	0.849	regulation of RNA splicing
GO:0031326	0.848	regulation of cellular biosynthetic process
GO:0051173	0.842	positive regulation of nitrogen compound metabolic process
GO:0031325	0.839	positive regulation of cellular metabolic process
GO:0071840	0.836	cellular component organization or biogenesis
GO:0009892	0.827	negative regulation of metabolic process
GO:0000398	0.820	mRNA splicing, via spliceosome
GO:0050684	0.803	regulation of mRNA processing
GO:0048024	0.792	regulation of mRNA splicing, via spliceosome
GO:0051172	0.791	negative regulation of nitrogen compound metabolic process
GO:0016043	0.788	cellular component organization
GO:0051254	0.769	positive regulation of RNA metabolic process
GO:0043933	0.622	protein-containing complex organization
GO:0006355	0.585	regulation of DNA-templated transcription
GO:0048523	0.541	negative regulation of cellular process
GO:0010605	0.514	negative regulation of macromolecule metabolic process
GO:0010557	0.479	positive regulation of macromolecule biosynthetic process
GO:0031328	0.467	positive regulation of cellular biosynthetic process
GO:0071826	0.376	ribonucleoprotein complex subunit organization
GO:0022618	0.365	ribonucleoprotein complex assembly
GO:0050896	0.359	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005654	0.988	nucleoplasm
GO:0032991	0.966	protein-containing complex
GO:0043232	0.867	intracellular non-membrane-bounded organelle
GO:1902494	0.608	catalytic complex
GO:1990904	0.549	ribonucleoprotein complex
GO:0070062	0.549	extracellular exosome
GO:0005681	0.543	spliceosomal complex
GO:0005737	0.534	cytoplasm
GO:0016020	0.493	membrane
GO:0044530	0.387	supraspliceosomal complex
GO:0005829	0.385	cytosol
GO:0071013	0.315	catalytic step 2 spliceosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]