StarFunc result for job id P38398

User Input

>input (1863 residues)
MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQ
CPLCKNDITKRSLQESTRFSQLVEELLKIICAFQLDTGLEYANSYNFAKKENNSPEHLKD
EVSIIQSMGYRNRAKRLLQSEPENPSLQETSLSVQLSNLGTVRTLRTKQRIQPQKTSVYI
ELGSDSSEDTVNKATYCSVGDQELLQITPQGTRDEISLDSAKKAACEFSETDVTNTEHHQ
PSNNDLNTTEKRAAERHPEKYQGSSVSNLHVEPCGTNTHASSLQHENSSLLLTKDRMNVE
KAEFCNKSKQPGLARSQHNRWAGSKETCNDRRTPSTEKKVDLNADPLCERKEWNKQKLPC
SENPRDTEDVPWITLNSSIQKVNEWFSRSDELLGSDDSHDGESESNAKVADVLDVLNEVD
EYSGSSEKIDLLASDPHEALICKSERVHSKSVESNIEDKIFGKTYRKKASLPNLSHVTEN
LIIGAFVTEPQIIQERPLTNKLKRKRRPTSGLHPEDFIKKADLAVQKTPEMINQGTNQTE
QNGQVMNITNSGHENKTKGDSIQNEKNPNPIESLEKESAFKTKAEPISSSISNMELELNI
HNSKAPKKNRLRRKSSTRHIHALELVVSRNLSPPNCTELQIDSCSSSEEIKKKKYNQMPV
RHSRNLQLMEGKEPATGAKKSNKPNEQTSKRHDSDTFPELKLTNAPGSFTKCSNTSELKE
FVNPSLPREEKEEKLETVKVSNNAEDPKDLMLSGERVLQTERSVESSSISLVPGTDYGTQ
ESISLLEVSTLGKAKTEPNKCVSQCAAFENPKGLIHGCSKDNRNDTEGFKYPLGHEVNHS
RETSIEMEESELDAQYLQNTFKVSKRQSFAPFSNPGNAEEECATFSAHSGSLKKQSPKVT
FECEQKEENQGKNESNIKPVQTVNITAGFPVVGQKDKPVDNAKCSIKGGSRFCLSSQFRG
NETGLITPNKHGLLQNPYRIPPLFPIKSFVKTKCKKNLLEENFEEHSMSPEREMGNENIP
STVSTISRNNIRENVFKEASSSNINEVGSSTNEVGSSINEIGSSDENIQAELGRNRGPKL
NAMLRLGVLQPEVYKQSLPGSNCKHPEIKKQEYEEVVQTVNTDFSPYLISDNLEQPMGSS
HASQVCSETPDDLLDDGEIKEDTSFAENDIKESSAVFSKSVQKGELSRSPSPFTHTHLAQ
GYRRGAKKLESSEENLSSEDEELPCFQHLLFGKVNNIPSQSTRHSTVATECLSKNTEENL
LSLKNSLNDCSNQVILAKASQEHHLSEETKCSASLFSSQCSELEDLTANTNTQDPFLIGS
SKQMRHQSESQGVGLSDKELVSDDEERGTGLEENNQEEQSMDSNLGEAASGCESETSVSE
DCSGLSSQSDILTTQQRDTMQHNLIKLQQEMAELEAVLEQHGSQPSNSYPSIISDSSALE
DLRNPEQSTSEKAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVERSSPSK
CPSLDDRWYMHSCSGSLQNRNYPSQEELIKVVDVEEQQLEESGPHDLTETSYLPRQDLEG
TPYLESGISLFSDDPESDPSEDRAPESARVGNIPSSTSALKVPQLKVAESAQSPAAAHTT
DTAGYNAMEESVSREKPELTASTERVNKRMSMVVSGLTPEEFMLVYKFARKHHITLTNLI
TEETTHVVMKTDAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDV
VNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTL
GTGVHPIVVVQPDAWTEDNGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPH
SHY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P38398	1.000	1.000	0.000	1863	1.000	1.000	P38398.pdb.gz	BRCA1_HUMAN Breast cancer type 1 susceptibility protein OS=Homo sapiens OX=9606 GN=BRCA1 PE=1 SV=2
2	AFDB:P48754	0.187	0.191	0.000	1812	0.560	0.576	P48754.pdb.gz	BRCA1_MOUSE Breast cancer type 1 susceptibility protein homolog OS=Mus musculus OX=10090 GN=Brca1 PE=1 SV=3
3	AFDB:Q5PSV9	0.099	0.107	5.309E-14	1707	0.149	0.163	Q5PSV9.pdb.gz	MDC1_MOUSE Mediator of DNA damage checkpoint protein 1 OS=Mus musculus OX=10090 GN=Mdc1 PE=1 SV=1
4	PDB:7jzvA	0.052	0.362	4.767E-13	253	0.053	0.391	7jzvA.pdb.gz	BRCA1/BARD1 site-specific ubiquitylation of nucleosomal H2A is directed by BARD1.
5	AFDB:Q14676	0.097	0.088	7.476E-12	2089	0.143	0.128	Q14676.pdb.gz	MDC1_HUMAN Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1 PE=1 SV=3
6	AFDB:Q9VUB7	0.060	0.051	4.250E-9	2294	0.110	0.089	Q9VUB7.pdb.gz	Q9VUB7_DROME PAX transcription activation domain interacting protein OS=Drosophila melanogaster OX=7227 GN=Ptip PE=1 SV=3
7	AFDB:P97868	0.044	0.046	1.580E-7	1790	0.127	0.132	P97868.pdb.gz	RBBP6_MOUSE E3 ubiquitin-protein ligase RBBP6 OS=Mus musculus OX=10090 GN=Rbbp6 PE=1 SV=5
8	AFDB:Q95RC8	0.099	0.141	4.091E-7	1280	0.114	0.166	Q95RC8.pdb.gz	Q95RC8_DROME LD44171p OS=Drosophila melanogaster OX=7227 GN=mu2 PE=1 SV=1
9	AFDB:Q7Z6E9	0.050	0.052	4.359E-7	1792	0.120	0.125	Q7Z6E9.pdb.gz	RBBP6_HUMAN E3 ubiquitin-protein ligase RBBP6 OS=Homo sapiens OX=9606 GN=RBBP6 PE=1 SV=1
10	AFDB:H2KYH3	0.047	0.036	7.240E-7	2476	0.134	0.101	H2KYH3.pdb.gz	RING2_CAEEL E3 ubiquitin-protein ligase RING2 homolog spat-3 OS=Caenorhabditis elegans OX=6239 GN=spat-3 PE=3 SV=1
11	AFDB:O96685	0.101	0.146	2.128E-6	1261	0.106	0.157	O96685.pdb.gz	O96685_DROME Mutator 2 OS=Drosophila melanogaster OX=7227 GN=mu2 PE=1 SV=1
12	PDB:7lsyY	0.043	0.088	1.306E-5	855	0.024	0.051	7lsyY.pdb.gz	Structural basis of long-range to short-range synaptic transition in NHEJ.
13	PDB:4r8pL	0.038	0.266	9.942E-5	254	0.013	0.094	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
14	PDB:5dkaA	0.035	0.547	1.651E-4	96	0.012	0.229	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
15	PDB:5gm6a	0.032	0.442	1.427E-3	123	0.009	0.138	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
16	PDB:5l9uB	0.026	0.621	3.937E-3	71	0.008	0.211	5l9uB.pdb.gz
17	PDB:7qcdC	0.038	0.222	4.763E-3	267	0.009	0.060	7qcdC.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
18	PDB:8a3tU	0.028	0.379	1.086E-2	114	0.010	0.158	8a3tU.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
19	PDB:7nacn	0.039	0.152	1.233E-2	425	0.010	0.042	7nacn.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
20	PDB:5a31B	0.027	0.538	1.314E-2	84	0.008	0.179	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O54952	0.0	1849	1817	0.560	0.575	BRCA1_RAT Breast cancer type 1 susceptibility protein homolog OS=Rattus norvegicus OX=10116 GN=Brca1 PE=1 SV=1
2	P38398	0.0	3844	1863	1.000	1.000	BRCA1_HUMAN Breast cancer type 1 susceptibility protein OS=Homo sapiens OX=9606 GN=BRCA1 PE=1 SV=2
3	P48754	0.0	1845	1812	0.560	0.576	BRCA1_MOUSE Breast cancer type 1 susceptibility protein homolog OS=Mus musculus OX=10090 GN=Brca1 PE=1 SV=3
4	Q5YLB2	0.0	2799	1399	0.733	0.976	Q5YLB2_HUMAN Breast cancer type 1 susceptibility protein OS=Homo sapiens OX=9606 GN=BRCA1 PE=1 SV=1
5	Q9GKK8	0.0	3773	1863	0.984	0.984	BRCA1_PANTR Breast cancer type 1 susceptibility protein homolog OS=Pan troglodytes OX=9598 GN=BRCA1 PE=2 SV=2
6	Q90X96	2.94e-79	293	1579	0.118	0.139	Q90X96_XENLA RING-type E3 ubiquitin transferase BRCA1 OS=Xenopus laevis OX=8355 GN=brca1.L PE=1 SV=1
7	Q90Z51	5.19e-79	293	1749	0.070	0.075	Q90Z51_CHICK RING-type E3 ubiquitin transferase OS=Gallus gallus OX=9031 GN=BRCA1 PE=2 SV=1
8	F4I443	1.01e-16	89.0	714	0.032	0.084	BARD1_ARATH BRCA1-associated RING domain protein 1 OS=Arabidopsis thaliana OX=3702 GN=BARD1 PE=1 SV=1
9	Q8RXD4	1.74e-14	81.6	941	0.031	0.061	BRCA1_ARATH Protein BREAST CANCER SUSCEPTIBILITY 1 homolog OS=Arabidopsis thaliana OX=3702 GN=BRCA1 PE=1 SV=1
10	Q2L6J1	5.33e-09	63.2	425	0.018	0.078	Q2L6J1_HUMAN RING-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 GN=TRIM31 PE=1 SV=1
11	Q9BZY9	5.33e-09	63.2	425	0.018	0.078	TRI31_HUMAN E3 ubiquitin-protein ligase TRIM31 OS=Homo sapiens OX=9606 GN=TRIM31 PE=1 SV=2
12	B6VQ60	8.76e-09	62.8	612	0.018	0.056	BRCA1_CAEEL Breast cancer type 1 susceptibility protein homolog OS=Caenorhabditis elegans OX=6239 GN=brc-1 PE=1 SV=1
13	A0A0C4DGA6	6.59e-08	60.5	1008	0.014	0.027	A0A0C4DGA6_HUMAN Helicase like transcription factor OS=Homo sapiens OX=9606 GN=HLTF PE=1 SV=1
14	Q14527	6.59e-08	60.5	1009	0.014	0.027	HLTF_HUMAN Helicase-like transcription factor OS=Homo sapiens OX=9606 GN=HLTF PE=1 SV=2
15	A0AVN2	1.16e-07	59.3	777	0.022	0.053	A0AVN2_HUMAN BRCA1 associated RING domain 1 OS=Homo sapiens OX=9606 GN=BARD1 PE=1 SV=1
16	Q99728	1.19e-07	59.3	777	0.022	0.053	BARD1_HUMAN BRCA1-associated RING domain protein 1 OS=Homo sapiens OX=9606 GN=BARD1 PE=1 SV=2
17	A0A087X2H0	1.55e-07	58.9	641	0.022	0.064	A0A087X2H0_HUMAN BRCA1 associated RING domain 1 OS=Homo sapiens OX=9606 GN=BARD1 PE=1 SV=2
18	Q3UWZ0	2.37e-07	57.8	467	0.012	0.047	TRI75_MOUSE Tripartite motif-containing protein 75 OS=Mus musculus OX=10090 GN=Trim75 PE=1 SV=1
19	Q9P3U8	3.18e-07	57.4	468	0.016	0.062	YJ95_SCHPO Uncharacterized RING finger protein C548.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC548.05c PE=4 SV=1
20	Q95216	4.57e-07	57.8	1005	0.012	0.023	HLTF_RABIT Helicase-like transcription factor OS=Oryctolagus cuniculus OX=9986 GN=HLTF PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00533 BRCT	6.1e-16	69.9	BRCA1 C Terminus (BRCT) domain
2	PF16589 BRCT_2	8.6	18.2	BRCT domain, a BRCA1 C-terminus domain
3	PF12820 BRCT_assoc	1.2e-76	267.5	Serine-rich domain associated with BRCT
4	PF14447 Prok-RING_4	16	16.7	Prokaryotic RING finger family 4
5	PF12861 zf-ANAPC11	7.4	18.0	Anaphase-promoting complex subunit 11 RING-H2 finger
6	PF00097 zf-C3HC4	4.8e-06	37.6	Zinc finger, C3HC4 type (RING finger)
7	PF13923 zf-C3HC4_2	1.8e-05	35.8	Zinc finger, C3HC4 type (RING finger)
8	PF13920 zf-C3HC4_3	0.0027	28.8	Zinc finger, C3HC4 type (RING finger)
9	PF15227 zf-C3HC4_4	0.0023	29.3	zinc finger of C3HC4-type, RING
10	PF11789 zf-Nse	0.16	23.2	Zinc-finger of the MIZ type in Nse subunit
11	PF12678 zf-rbx1	56	15.4	RING-H2 zinc finger domain
12	PF16685 zf-RING_10	9.9	17.7	zinc RING finger of MSL2
13	PF13639 zf-RING_2	0.015	27.0	Ring finger domain
14	PF14634 zf-RING_5	0.041	25.2	zinc-RING finger domain
15	PF14835 zf-RING_6	1.2	20.3	zf-RING of BARD1-type protein
16	PF13445 zf-RING_UBOX	0.0031	28.8	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000418960

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000259008	0.999	Fanconi anemia group J protein
2	9606.ENSP00000260810	0.999	DNA topoisomerase 2-binding protein 1
3	9606.ENSP00000260947	0.999	BRCA1-associated RING domain protein 1
4	9606.ENSP00000261584	0.999	Partner and localizer of BRCA2
5	9606.ENSP00000265433	0.999	Nibrin
6	9606.ENSP00000269305	0.999	Cellular tumor antigen p53
7	9606.ENSP00000278616	0.999	Serine-protein kinase ATM
8	9606.ENSP00000287647	0.999	Fanconi anemia group D2 protein
9	9606.ENSP00000349722	0.999	Ubiquitin conjugating enzyme E2 D3
10	9606.ENSP00000352408	0.999	BRISC and BRCA1-A complex member 1
11	9606.ENSP00000358474	0.999	Lys-63-specific deubiquitinase BRCC36
12	9606.ENSP00000365588	0.999	Mediator of DNA damage checkpoint protein 1
13	9606.ENSP00000366434	0.999	BRCA1-A complex subunit RAP80
14	9606.ENSP00000369497	0.999	Breast cancer type 2 susceptibility protein
15	9606.ENSP00000369857	0.999	BRCA1-A complex subunit Abraxas 1
16	9606.ENSP00000371475	0.999	TP53-binding protein 1
17	9606.ENSP00000372023	0.999	Serine/threonine-protein kinase Chk2
18	9606.ENSP00000372088	0.999	DNA repair protein RAD51 homolog 1
19	9606.ENSP00000373952	0.999	Fanconi anemia group A protein
20	9606.ENSP00000382628	0.999	DNA endonuclease RBBP8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140096	0.997	catalytic activity, acting on a protein
GO:0019787	0.991	ubiquitin-like protein transferase activity
GO:0003676	0.989	nucleic acid binding
GO:0003677	0.984	DNA binding
GO:0019899	0.958	enzyme binding
GO:0004842	0.941	ubiquitin-protein transferase activity
GO:0043565	0.916	sequence-specific DNA binding
GO:0003690	0.908	double-stranded DNA binding
GO:1990837	0.880	sequence-specific double-stranded DNA binding
GO:0000976	0.866	transcription cis-regulatory region binding
GO:0140110	0.812	transcription regulator activity
GO:0003723	0.789	RNA binding
GO:0043167	0.786	ion binding
GO:0003712	0.756	transcription coregulator activity
GO:0044389	0.754	ubiquitin-like protein ligase binding
GO:0008270	0.745	zinc ion binding
GO:0003713	0.737	transcription coactivator activity
GO:0002039	0.730	p53 binding
GO:0042802	0.721	identical protein binding
GO:0070063	0.531	RNA polymerase binding
GO:0031625	0.516	ubiquitin protein ligase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0043170	0.994	macromolecule metabolic process
GO:0044237	0.990	cellular metabolic process
GO:0050896	0.989	response to stimulus
GO:0050794	0.986	regulation of cellular process
GO:0060255	0.982	regulation of macromolecule metabolic process
GO:0051171	0.982	regulation of nitrogen compound metabolic process
GO:0010604	0.970	positive regulation of macromolecule metabolic process
GO:0051173	0.969	positive regulation of nitrogen compound metabolic process
GO:0048522	0.961	positive regulation of cellular process
GO:0051716	0.949	cellular response to stimulus
GO:0019219	0.948	regulation of nucleobase-containing compound metabolic process
GO:0048523	0.946	negative regulation of cellular process
GO:0033554	0.942	cellular response to stress
GO:0009889	0.935	regulation of biosynthetic process
GO:0044260	0.935	cellular macromolecule metabolic process
GO:0031325	0.935	positive regulation of cellular metabolic process
GO:0090304	0.935	nucleic acid metabolic process
GO:0009892	0.932	negative regulation of metabolic process
GO:0010556	0.931	regulation of macromolecule biosynthetic process
GO:0031326	0.931	regulation of cellular biosynthetic process
GO:0010468	0.930	regulation of gene expression
GO:0051252	0.927	regulation of RNA metabolic process
GO:1901564	0.926	organonitrogen compound metabolic process
GO:0006974	0.913	cellular response to DNA damage stimulus
GO:0019538	0.913	protein metabolic process
GO:2001141	0.907	regulation of RNA biosynthetic process
GO:0006259	0.895	DNA metabolic process
GO:0006355	0.895	regulation of DNA-templated transcription
GO:0010605	0.883	negative regulation of macromolecule metabolic process
GO:0070647	0.882	protein modification by small protein conjugation or removal
GO:0051172	0.881	negative regulation of nitrogen compound metabolic process
GO:0045935	0.880	positive regulation of nucleobase-containing compound metabolic process
GO:0031324	0.857	negative regulation of cellular metabolic process
GO:0032446	0.832	protein modification by small protein conjugation
GO:0006281	0.822	DNA repair
GO:0051726	0.797	regulation of cell cycle
GO:0009891	0.762	positive regulation of biosynthetic process
GO:0051246	0.757	regulation of protein metabolic process
GO:0031328	0.751	positive regulation of cellular biosynthetic process
GO:0007049	0.749	cell cycle
GO:0010557	0.749	positive regulation of macromolecule biosynthetic process
GO:0048583	0.742	regulation of response to stimulus
GO:0016567	0.738	protein ubiquitination
GO:0007165	0.725	signal transduction
GO:0022402	0.682	cell cycle process
GO:0010564	0.571	regulation of cell cycle process
GO:0045934	0.565	negative regulation of nucleobase-containing compound metabolic process
GO:0051052	0.537	regulation of DNA metabolic process
GO:1902680	0.498	positive regulation of RNA biosynthetic process
GO:1903508	0.493	positive regulation of nucleic acid-templated transcription
GO:0045893	0.458	positive regulation of DNA-templated transcription
GO:0000278	0.455	mitotic cell cycle
GO:0031399	0.451	regulation of protein modification process
GO:0035556	0.437	intracellular signal transduction
GO:1903047	0.424	mitotic cell cycle process
GO:0051247	0.423	positive regulation of protein metabolic process
GO:0007346	0.422	regulation of mitotic cell cycle
GO:1901987	0.422	regulation of cell cycle phase transition
GO:0006302	0.410	double-strand break repair
GO:0048584	0.402	positive regulation of response to stimulus
GO:1901990	0.400	regulation of mitotic cell cycle phase transition
GO:0045786	0.392	negative regulation of cell cycle
GO:0031401	0.389	positive regulation of protein modification process
GO:0042221	0.385	response to chemical
GO:0023051	0.376	regulation of signaling
GO:0010646	0.376	regulation of cell communication
GO:0009966	0.372	regulation of signal transduction
GO:0010948	0.369	negative regulation of cell cycle process
GO:0080134	0.345	regulation of response to stress
GO:1901988	0.335	negative regulation of cell cycle phase transition
GO:0010033	0.333	response to organic substance
GO:2001020	0.331	regulation of response to DNA damage stimulus
GO:0051054	0.327	positive regulation of DNA metabolic process
GO:0009890	0.321	negative regulation of biosynthetic process
GO:0006357	0.307	regulation of transcription by RNA polymerase II
GO:0006282	0.305	regulation of DNA repair
GO:0051248	0.300	negative regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.980	protein-containing complex
GO:0043232	0.967	intracellular non-membrane-bounded organelle
GO:0016604	0.924	nuclear body
GO:0005737	0.915	cytoplasm
GO:0005694	0.852	chromosome
GO:1902494	0.851	catalytic complex
GO:0000228	0.673	nuclear chromosome
GO:0000151	0.628	ubiquitin ligase complex
GO:0000152	0.564	nuclear ubiquitin ligase complex
GO:0005886	0.527	plasma membrane
GO:1990904	0.511	ribonucleoprotein complex
GO:0070531	0.492	BRCA1-A complex
GO:0070533	0.459	BRCA1-C complex
GO:0000793	0.448	condensed chromosome
GO:0000794	0.404	condensed nuclear chromosome
GO:0070532	0.371	BRCA1-B complex
GO:0031436	0.371	BRCA1-BARD1 complex
GO:0000800	0.349	lateral element
GO:1990391	0.338	DNA repair complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.992	Transferases.

[back to server]