StarFunc result for job id P38484

User Input

>input (337 residues)
MRPTLLWSLLLLLGVFAAAAAAPPDPLSQLPAPQHPKIRLYNAEQVLSWEPVALSNSTRP
VVYQVQFKYTDSKWFTADIMSIGVNCTQITATECDFTAASPSAGFPMDFNVTLRLRAELG
ALHSAWVTMPWFQHYRNVTVGPPENIEVTPGEGSLIIRFSSPFDIADTSTAFFCYYVHYW
EKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHLSNISCYETMAD
ASTELQQVILISVGTFSLLSVLAGACFFLVLKYRGLIKYWFHTPPSIPLQIEEYLKDPTQ
PILEALDKDSSPKDDVWDSVSIISFPEKEQEDVLQTL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P38484	1.000	1.000	1.311E-61	337	1.000	1.000	P38484.pdb.gz	INGR2_HUMAN Interferon gamma receptor 2 OS=Homo sapiens OX=9606 GN=IFNGR2 PE=1 SV=2
2	AFDB:D4A109	0.730	0.744	3.124E-41	330	0.599	0.612	D4A109.pdb.gz	D4A109_RAT Interferon gamma receptor 2 OS=Rattus norvegicus OX=10116 GN=Ifngr2 PE=4 SV=1
3	AFDB:Q3UVK9	0.711	0.722	1.116E-38	332	0.585	0.593	Q3UVK9.pdb.gz	Q3UVK9_MOUSE Fibronectin type-III domain-containing protein OS=Mus musculus OX=10090 GN=Ifngr2 PE=2 SV=1
4	AFDB:Q61190	0.509	0.493	7.991E-20	349	0.252	0.244	Q61190.pdb.gz	I10R2_MOUSE Interleukin-10 receptor subunit beta OS=Mus musculus OX=10090 GN=Il10rb PE=1 SV=1
5	AFDB:K7NA32	0.551	0.467	1.230E-19	405	0.226	0.188	K7NA32.pdb.gz	IRA1A_ONCMY Interferon alpha/beta receptor 1a OS=Oncorhynchus mykiss OX=8022 GN=ifnar1a PE=2 SV=1
6	AFDB:Q08334	0.500	0.517	1.446E-19	325	0.240	0.249	Q08334.pdb.gz	I10R2_HUMAN Interleukin-10 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL10RB PE=1 SV=2
7	AFDB:A0FJI0	0.579	0.534	3.077E-19	368	0.208	0.190	A0FJI0.pdb.gz
8	AFDB:Q9UHF4	0.496	0.318	3.946E-17	553	0.196	0.119	Q9UHF4.pdb.gz	I20RA_HUMAN Interleukin-20 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL20RA PE=1 SV=2
9	AFDB:Q6PHB0	0.494	0.320	7.955E-17	546	0.231	0.143	Q6PHB0.pdb.gz	I20RA_MOUSE Interleukin-20 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il20ra PE=2 SV=2
10	AFDB:K9JA28	0.511	0.319	1.225E-16	567	0.187	0.111	K9JA28.pdb.gz	INLR1_CHICK Interferon lambda receptor 1 OS=Gallus gallus OX=9031 GN=IFNLR1 PE=2 SV=1
11	PDB:7u7nC	0.396	0.603	7.842E-10	200	0.113	0.190	7u7nC.pdb.gz
12	PDB:7z0lB	0.358	0.335	1.207E-9	370	0.145	0.132	7z0lB.pdb.gz
13	PDB:3besR	0.415	0.539	8.553E-8	250	0.089	0.120	3besR.pdb.gz
14	PDB:6pxvA	0.282	0.136	1.413E-6	823	0.089	0.036	6pxvA.pdb.gz
15	PDB:5mj3A	0.308	0.336	7.519E-6	302	0.065	0.073	5mj3A.pdb.gz
16	PDB:8eyyA	0.296	0.149	1.158E-5	775	0.095	0.041	8eyyA.pdb.gz
17	PDB:6pyhD	0.266	0.126	1.361E-5	798	0.077	0.033	6pyhD.pdb.gz
18	PDB:8dtlA	0.268	0.142	2.334E-5	741	0.083	0.038	8dtlA.pdb.gz
19	PDB:7bwaA	0.273	0.158	3.279E-4	674	0.071	0.036	7bwaA.pdb.gz
20	PDB:5iv5BJ	0.249	0.092	7.363E-4	1004	0.083	0.028	5iv5BJ.pdb.gz	Structure of the T4 baseplate and its function in triggering sheath contraction.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P38484	0.0	696	337	1.000	1.000	INGR2_HUMAN Interferon gamma receptor 2 OS=Homo sapiens OX=9606 GN=IFNGR2 PE=1 SV=2
2	D4A109	2.14e-132	382	330	0.570	0.582	D4A109_RAT Interferon gamma receptor 2 OS=Rattus norvegicus OX=10116 GN=Ifngr2 PE=4 SV=1
3	Q63953	7.02e-128	370	332	0.564	0.572	Q63953_MOUSE Ifngr2 protein OS=Mus musculus OX=10090 GN=Ifngr2 PE=1 SV=1
4	Q3UVK9	9.12e-128	370	332	0.564	0.572	Q3UVK9_MOUSE Fibronectin type-III domain-containing protein OS=Mus musculus OX=10090 GN=Ifngr2 PE=2 SV=1
5	Q8C352	5.15e-70	219	213	0.332	0.526	Q8C352_MOUSE Fibronectin type-III domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Ifngr2 PE=2 SV=1
6	Q61190	2.46e-20	92.4	349	0.243	0.235	I10R2_MOUSE Interleukin-10 receptor subunit beta OS=Mus musculus OX=10090 GN=Il10rb PE=1 SV=1
7	Q08334	2.86e-20	92.0	325	0.252	0.262	I10R2_HUMAN Interleukin-10 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL10RB PE=1 SV=2
8	A0A142K3A7	9.15e-14	73.2	302	0.199	0.222	A0A142K3A7_MOUSE Interleukin-20 receptor subunit beta OS=Mus musculus OX=10090 GN=Il20rb PE=2 SV=1
9	E9Q9A6	9.26e-13	70.1	308	0.196	0.214	E9Q9A6_MOUSE Interleukin 20 receptor beta OS=Mus musculus OX=10090 GN=Il20rb PE=4 SV=1
10	Q6UXL0	2.24e-11	66.2	311	0.199	0.215	I20RB_HUMAN Interleukin-20 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL20RB PE=1 SV=1
11	K7NA32	5.35e-10	62.4	405	0.208	0.173	IRA1A_ONCMY Interferon alpha/beta receptor 1a OS=Oncorhynchus mykiss OX=8022 GN=ifnar1a PE=2 SV=1
12	K7NAJ3	2.74e-08	57.0	388	0.205	0.178	IRA1B_ONCMY Interferon alpha/beta receptor 1b OS=Oncorhynchus mykiss OX=8022 GN=ifnar1b PE=2 SV=1
13	K9JA28	2.65e-07	54.3	567	0.178	0.106	INLR1_CHICK Interferon lambda receptor 1 OS=Gallus gallus OX=9031 GN=IFNLR1 PE=2 SV=1
14	P17181	6.06e-07	53.1	557	0.166	0.101	INAR1_HUMAN Interferon alpha/beta receptor 1 OS=Homo sapiens OX=9606 GN=IFNAR1 PE=1 SV=3
15	Q6PHB0	1.18e-04	46.2	546	0.190	0.117	I20RA_MOUSE Interleukin-20 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il20ra PE=2 SV=2
16	Q9UHF4	2.38e-04	45.1	553	0.178	0.108	I20RA_HUMAN Interleukin-20 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL20RA PE=1 SV=2
17	A0A0G2JXD8	4.51e-04	44.3	439	0.211	0.162	A0A0G2JXD8_RAT Interferon alpha and beta receptor subunit 1 OS=Rattus norvegicus OX=10116 GN=Ifnar1 PE=4 SV=1
18	A0A8I6AH72	4.57e-04	44.3	582	0.211	0.122	A0A8I6AH72_RAT Interferon alpha and beta receptor subunit 1 OS=Rattus norvegicus OX=10116 GN=Ifnar1 PE=4 SV=1
19	D3ZDS9	4.72e-04	44.3	593	0.211	0.120	D3ZDS9_RAT Interferon alpha and beta receptor subunit 1 OS=Rattus norvegicus OX=10116 GN=Ifnar1 PE=4 SV=2
20	P33896	7.31e-04	43.5	590	0.178	0.102	INAR1_MOUSE Interferon alpha/beta receptor 1 OS=Mus musculus OX=10090 GN=Ifnar1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00041 fn3	0.00042	31.9	Fibronectin type III domain
2	PF09294 Interfer-bind	6.4e-05	34.6	Interferon-alpha/beta receptor, fibronectin type III
3	PF01108 Tissue_fac	2.5e-15	67.6	Tissue factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000290219

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356713	0.999	Interferon gamma receptor 1
2	9606.ENSP00000371067	0.998	Tyrosine-protein kinase JAK2
3	9606.ENSP00000343204	0.997	Tyrosine-protein kinase JAK1
4	9606.ENSP00000229135	0.995	Interferon gamma
5	9606.ENSP00000343957	0.950	Interferon alpha/beta receptor 2
6	9606.ENSP00000354394	0.940	Signal transducer and activator of transcription 1-alpha/beta
7	9606.ENSP00000339740	0.925	Calcium/calmodulin-dependent protein kinase type II subunit delta
8	9606.ENSP00000360683	0.914	Tyrosine-protein phosphatase non-receptor type 1
9	9606.ENSP00000319060	0.913	Calcium/calmodulin-dependent protein kinase type II subunit gamma
10	9606.ENSP00000340944	0.913	Tyrosine-protein phosphatase non-receptor type 11
11	9606.ENSP00000391592	0.911	Tyrosine-protein phosphatase non-receptor type 6
12	9606.ENSP00000379098	0.907	Calcium/calmodulin-dependent protein kinase type II subunit beta
13	9606.ENSP00000381412	0.907	Calcium/calmodulin-dependent protein kinase type II subunit alpha
14	9606.ENSP00000378217	0.904	Protein kinase C delta type
15	9606.ENSP00000270139	0.881	Interferon alpha/beta receptor 1
16	9606.ENSP00000431885	0.837	Non-receptor tyrosine-protein kinase TYK2
17	9606.ENSP00000369581	0.818	Interferon beta
18	9606.ENSP00000276927	0.816	Interferon alpha-1/13
19	9606.ENSP00000231228	0.807	Interleukin-12 subunit beta
20	9606.ENSP00000256078	0.804	GTPase KRas

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004904	1.000	interferon receptor activity
GO:0004906	0.591	type II interferon receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0050794	0.997	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0009615	0.973	response to virus
GO:0007166	0.965	cell surface receptor signaling pathway
GO:0048518	0.848	positive regulation of biological process
GO:0048522	0.767	positive regulation of cellular process
GO:0048583	0.753	regulation of response to stimulus
GO:0006950	0.615	response to stress
GO:0019222	0.598	regulation of metabolic process
GO:0006952	0.580	defense response
GO:0010646	0.485	regulation of cell communication
GO:0009893	0.441	positive regulation of metabolic process
GO:0009966	0.439	regulation of signal transduction
GO:0042221	0.409	response to chemical
GO:0010033	0.397	response to organic substance
GO:0002376	0.380	immune system process
GO:0060255	0.380	regulation of macromolecule metabolic process
GO:0070887	0.370	cellular response to chemical stimulus
GO:0048584	0.352	positive regulation of response to stimulus
GO:0071345	0.320	cellular response to cytokine stimulus
GO:0010604	0.317	positive regulation of macromolecule metabolic process
GO:0031323	0.311	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.998	endomembrane system
GO:0005783	0.994	endoplasmic reticulum
GO:0043233	0.333	organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]