StarFunc result for job id P38570

User Input

>input (1179 residues)
MWLFHTLLCIASLALLAAFNVDVARPWLTPKGGAPFVLSSLLHQDPSTNQTWLLVTSPRT
KRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVTVVRSHHGVLICIQVLVRRPHSLSS
ELTGTCSLLGPDLRPQAQANFFDLENLLDPDARVDTGDCYSNKEGGGEDDVNTARQRRAL
EKEEEEDKEEEEDEEEEEAGTEIAIILDGSGSIDPPDFQRAKDFISNMMRNFYEKCFECN
FALVQYGGVIQTEFDLRDSQDVMASLARVQNITQVGSVTKTASAMQHVLDSIFTSSHGSR
RKASKVMVVLTDGGIFEDPLNLTTVINSPKMQGVERFAIGVGEEFKSARTARELNLIASD
PDETHAFKVTNYMALDGLLSKLRYNIISMEGTVGDALHYQLAQIGFSAQILDERQVLLGA
VGAFDWSGGALLYDTRSRRGRFLNQTAAAAADAEAAQYSYLGYAVAVLHKTCSLSYIAGA
PRYKHHGAVFELQKEGREASFLPVLEGEQMGSYFGSELCPVDIDMDGSTDFLLVAAPFYH
VHGEEGRVYVYRLSEQDGSFSLARILSGHPGFTNARFGFAMAAMGDLSQDKLTDVAIGAP
LEGFGADDGASFGSVYIYNGHWDGLSASPSQRIRASTVAPGLQYFGMSMAGGFDISGDGL
ADITVGTLGQAVVFRSRPVVRLKVSMAFTPSALPIGFNGVVNVRLCFEISSVTTASESGL
REALLNFTLDVDVGKQRRRLQCSDVRSCLGCLREWSSGSQLCEDLLLMPTEGELCEEDCF
SNASVKVSYQLQTPEGQTDHPQPILDRYTEPFAIFQLPYEKACKNKLFCVAELQLATTVS
QQELVVGLTKELTLNINLTNSGEDSYMTSMALNYPRNLQLKRMQKPPSPNIQCDDPQPVA
SVLIMNCRIGHPVLKRSSAHVSVVWQLEENAFPNRTADITVTVTNSNERRSLANETHTLQ
FRHGFVAVLSKPSIMYVNTGQGLSHHKEFLFHVHGENLFGAEYQLQICVPTKLRGLQVVA
VKKLTRTQASTVCTWSQERACAYSSVQHVEEWHSVSCVIASDKENVTVAAEISWDHSEEL
LKDVTELQILGEISFNKSLYEGLNAENHRTKITVVFLKDEKYHSLPIIIKGSVGGLLVLI
VILVILFKCGFFKRKYQQLNLESIRKAQLKSENLLEEEN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2JVR6	0.552	0.557	0.000	1167	0.689	0.696	A0A0G2JVR6.pdb.gz	A0A0G2JVR6_RAT Integrin subunit alpha E OS=Rattus norvegicus OX=10116 GN=Itgae PE=3 SV=2
2	AFDB:M0R6T8	0.541	0.545	0.000	1169	0.696	0.701	M0R6T8.pdb.gz	M0R6T8_RAT Integrin subunit alpha E OS=Rattus norvegicus OX=10116 GN=Itgae PE=3 SV=1
3	AFDB:P38570	1.000	1.000	0.000	1179	1.000	1.000	P38570.pdb.gz	ITAE_HUMAN Integrin alpha-E OS=Homo sapiens OX=9606 GN=ITGAE PE=1 SV=3
4	AFDB:Q60677	0.749	0.756	0.000	1167	0.693	0.700	Q60677.pdb.gz	ITAE_MOUSE Integrin alpha-E OS=Mus musculus OX=10090 GN=Itgae PE=2 SV=2
5	AFDB:Q9QYE7	0.519	0.526	5.301E-97	1161	0.272	0.276	Q9QYE7.pdb.gz	ITAD_RAT Integrin alpha-D OS=Rattus norvegicus OX=10116 GN=Itgad PE=2 SV=1
6	AFDB:Q13349	0.538	0.544	1.773E-95	1161	0.277	0.281	Q13349.pdb.gz	ITAD_HUMAN Integrin alpha-D OS=Homo sapiens OX=9606 GN=ITGAD PE=1 SV=2
7	AFDB:P11215	0.501	0.511	6.444E-95	1152	0.275	0.281	P11215.pdb.gz	ITAM_HUMAN Integrin alpha-M OS=Homo sapiens OX=9606 GN=ITGAM PE=1 SV=2
8	AFDB:A0A0G2K4L8	0.468	0.474	2.047E-93	1161	0.285	0.289	A0A0G2K4L8.pdb.gz	A0A0G2K4L8_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=3 SV=2
9	AFDB:Q9QXH4	0.545	0.548	3.430E-93	1169	0.269	0.271	Q9QXH4.pdb.gz	ITAX_MOUSE Integrin alpha-X OS=Mus musculus OX=10090 GN=Itgax PE=1 SV=1
10	AFDB:P05555	0.475	0.485	6.053E-93	1153	0.282	0.288	P05555.pdb.gz	ITAM_MOUSE Integrin alpha-M OS=Mus musculus OX=10090 GN=Itgam PE=1 SV=2
11	PDB:4nehA	0.444	0.479	8.477E-84	1084	0.243	0.265	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
12	PDB:4nenA	0.443	0.487	1.307E-82	1063	0.242	0.268	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
13	PDB:7uslA	0.357	0.480	5.617E-61	856	0.176	0.243	7uslA.pdb.gz	Structural basis for non-canonical integrin engagement by Bordetella adenylate cyclase toxin.
14	PDB:3k6sC	0.412	0.535	3.017E-56	885	0.197	0.262	3k6sC.pdb.gz	Structure of an integrin with an alphaI domain, complement receptor type 4.
15	PDB:3fcsA	0.411	0.520	3.370E-48	913	0.167	0.216	3fcsA.pdb.gz	Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.
16	PDB:4g1eA	0.409	0.488	2.369E-45	964	0.172	0.211	4g1eA.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
17	PDB:7nxdA	0.360	0.453	1.236E-44	905	0.143	0.187	7nxdA.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
18	PDB:7sqcO0	0.085	0.086	8.233E-9	1140	0.061	0.063	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
19	PDB:5a42A	0.129	0.104	9.128E-9	1597	0.066	0.049	5a42A.pdb.gz
20	PDB:7q1yA	0.107	0.098	2.699E-8	1374	0.065	0.056	7q1yA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JVR6	0.0	1627	1150	0.682	0.699	A0A0G2JVR6_RAT Integrin subunit alpha E OS=Rattus norvegicus OX=10116 GN=Itgae PE=3 SV=2
2	A0A8I5Y1Q1	0.0	1440	1028	0.601	0.689	A0A8I5Y1Q1_RAT Integrin subunit alpha E OS=Rattus norvegicus OX=10116 GN=Itgae PE=3 SV=1
3	A0A8I6ACC3	0.0	1509	1096	0.631	0.679	A0A8I6ACC3_RAT VWFA domain-containing protein OS=Rattus norvegicus OX=10116 GN=Itgae PE=3 SV=1
4	M0R6T8	0.0	1674	1169	0.696	0.701	M0R6T8_RAT Integrin subunit alpha E OS=Rattus norvegicus OX=10116 GN=Itgae PE=3 SV=1
5	P38570	0.0	2451	1179	1.000	1.000	ITAE_HUMAN Integrin alpha-E OS=Homo sapiens OX=9606 GN=ITGAE PE=1 SV=3
6	Q60677	0.0	1657	1167	0.696	0.703	ITAE_MOUSE Integrin alpha-E OS=Mus musculus OX=10090 GN=Itgae PE=2 SV=2
7	G3V8L7	9.65e-128	422	1151	0.270	0.276	G3V8L7_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=3 SV=2
8	A0A0G2K4L8	2.01e-127	421	1151	0.270	0.276	A0A0G2K4L8_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=3 SV=2
9	A0A8I5Y8A4	2.61e-127	421	1141	0.270	0.279	A0A8I5Y8A4_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=1 SV=1
10	Q9JI30	3.98e-127	421	1151	0.270	0.276	Q9JI30_RAT Integrin beta 2 alpha subunit OS=Rattus norvegicus OX=10116 GN=Itgam PE=2 SV=1
11	Q3V0T4	1.24e-125	417	1168	0.260	0.262	ITAD_MOUSE Integrin alpha-D OS=Mus musculus OX=10090 GN=Itgad PE=1 SV=1
12	P05555	1.53e-125	416	1153	0.265	0.271	ITAM_MOUSE Integrin alpha-M OS=Mus musculus OX=10090 GN=Itgam PE=1 SV=2
13	Q9QYE7	1.06e-124	414	1161	0.254	0.258	ITAD_RAT Integrin alpha-D OS=Rattus norvegicus OX=10116 GN=Itgad PE=2 SV=1
14	P11215	2.32e-123	410	1152	0.262	0.268	ITAM_HUMAN Integrin alpha-M OS=Homo sapiens OX=9606 GN=ITGAM PE=1 SV=2
15	A0A8I5ZVY4	1.11e-118	396	1088	0.265	0.287	A0A8I5ZVY4_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=1 SV=1
16	Q13349	1.56e-118	397	1161	0.255	0.259	ITAD_HUMAN Integrin alpha-D OS=Homo sapiens OX=9606 GN=ITGAD PE=1 SV=2
17	Q9QXH4	2.54e-116	391	1169	0.249	0.251	ITAX_MOUSE Integrin alpha-X OS=Mus musculus OX=10090 GN=Itgax PE=1 SV=1
18	P20702	8.78e-110	373	1163	0.254	0.257	ITAX_HUMAN Integrin alpha-X OS=Homo sapiens OX=9606 GN=ITGAX PE=1 SV=3
19	P61625	7.53e-98	340	1165	0.210	0.213	ITAL_BOVIN Integrin alpha-L OS=Bos taurus OX=9913 GN=ITGAL PE=1 SV=1
20	F1LP44	3.99e-96	335	1161	0.212	0.215	F1LP44_RAT Integrin subunit alpha L OS=Rattus norvegicus OX=10116 GN=Itgal PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01839 FG-GAP	7e-14	62.6	FG-GAP repeat
2	PF13517 FG-GAP_3	0.0037	29.1	FG-GAP-like repeat
3	PF18698 HisK_sensor	2.5e+02	13.4	Histidine kinase sensor domain
4	PF00357 Integrin_alpha	1	20.5	Integrin alpha cytoplasmic region
5	PF08441 Integrin_alpha2	1.4e-21	88.8	Integrin alpha
6	PF00092 VWA	2.1e-34	130.8	von Willebrand factor type A domain
7	PF13519 VWA_2	4e-09	48.5	von Willebrand factor type A domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263087

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261769	0.999	Cadherin-1
2	9606.ENSP00000267082	0.999	Integrin beta-7
3	9606.ENSP00000344456	0.931	Catenin beta-1
4	9606.ENSP00000303939	0.917	Cytotoxic T-lymphocyte protein 4
5	9606.ENSP00000304669	0.909	Catenin alpha-1
6	9606.ENSP00000264246	0.907	T-lymphocyte activation antigen CD80
7	9606.ENSP00000377508	0.902	Junction plakoglobin
8	9606.ENSP00000324890	0.885	T-cell-specific surface glycoprotein CD28
9	9606.ENSP00000222573	0.877	Integrin beta-8
10	9606.ENSP00000379350	0.866	Integrin beta-1
11	9606.ENSP00000380948	0.861	Integrin beta-2
12	9606.ENSP00000283249	0.853	Integrin beta-6
13	9606.ENSP00000011653	0.843	T-cell surface glycoprotein CD4
14	9606.ENSP00000386559	0.842	T-cell surface glycoprotein CD8 alpha chain
15	9606.ENSP00000452786	0.842	Integrin beta-3
16	9606.ENSP00000296181	0.839	Integrin beta-5
17	9606.ENSP00000200181	0.834	Integrin beta-4
18	9606.ENSP00000365380	0.833	Forkhead box protein P3
19	9606.ENSP00000243440	0.809	Basic leucine zipper transcriptional factor ATF-like 3
20	9606.ENSP00000027335	0.802	Cadherin-17

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0044877	0.992	protein-containing complex binding
GO:0038023	0.964	signaling receptor activity
GO:0050839	0.854	cell adhesion molecule binding
GO:0005102	0.746	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0007155	0.989	cell adhesion
GO:0065007	0.540	biological regulation
GO:0050789	0.534	regulation of biological process
GO:0050896	0.489	response to stimulus
GO:0050794	0.453	regulation of cellular process
GO:0051716	0.386	cellular response to stimulus
GO:0048518	0.335	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0032991	0.975	protein-containing complex
GO:0098796	0.963	membrane protein complex
GO:0043235	0.950	receptor complex
GO:0098797	0.948	plasma membrane protein complex
GO:0098636	0.922	protein complex involved in cell adhesion
GO:0098802	0.922	plasma membrane signaling receptor complex
GO:0008305	0.885	integrin complex
GO:0009986	0.839	cell surface
GO:0043231	0.734	intracellular membrane-bounded organelle
GO:0005737	0.669	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]