StarFunc result for job id P38936

User Input

>input (164 residues)
MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLE
GDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLV
PRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RCX5	0.533	0.533	4.427E-24	164	1.000	1.000	A0A024RCX5.pdb.gz
2	AFDB:Q64315	0.514	0.514	3.967E-17	164	0.756	0.756	Q64315.pdb.gz	Q64315_RAT Cyclin-dependent kinase inhibitor 1A OS=Rattus norvegicus OX=10116 GN=Cdkn1a PE=2 SV=1
3	AFDB:A5WWG3	0.428	0.407	1.097E-7	173	0.335	0.318	A5WWG3.pdb.gz
4	AFDB:Q91603	0.442	0.348	3.357E-7	210	0.293	0.229	Q91603.pdb.gz	Q91603_XENLA XICL OS=Xenopus laevis OX=8355 GN=Xicl PE=2 SV=1
5	AFDB:P46527	0.403	0.336	9.579E-7	198	0.293	0.242	P46527.pdb.gz	CDN1B_HUMAN Cyclin-dependent kinase inhibitor 1B OS=Homo sapiens OX=9606 GN=CDKN1B PE=1 SV=1
6	AFDB:Q6IQT7	0.382	0.296	3.144E-6	212	0.244	0.189	Q6IQT7.pdb.gz	Q6IQT7_DANRE Cyclin-dependent kinase inhibitor 1C OS=Danio rerio OX=7955 GN=cdkn1c PE=2 SV=1
7	AFDB:O08769	0.394	0.331	4.459E-6	197	0.268	0.223	O08769.pdb.gz	O08769_RAT Cyclin dependent kinase inhibitor OS=Rattus norvegicus OX=10116 GN=Cdkn1b PE=1 SV=1
8	PDB:7b5lP	0.332	0.631	7.133E-5	77	0.195	0.416	7b5lP.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
9	AFDB:Q22197	0.365	0.328	8.437E-4	184	0.268	0.239	Q22197.pdb.gz	CKI1_CAEEL Cyclin-dependent kinase inhibitor 1 OS=Caenorhabditis elegans OX=6239 GN=cki-1 PE=1 SV=1
10	AFDB:Q69DC1	0.412	0.200	9.703E-4	355	0.274	0.127	Q69DC1.pdb.gz	Q69DC1_RAT Cyclin-dependent kinase inhibitor 1C OS=Rattus norvegicus OX=10116 GN=Cdkn1c PE=3 SV=1
11	AFDB:G5EEJ2	0.378	0.245	1.376E-3	259	0.220	0.139	G5EEJ2.pdb.gz	G5EEJ2_CAEEL Cyclin-dependent kinase inhibitor OS=Caenorhabditis elegans OX=6239 GN=cki-2 PE=1 SV=1
12	PDB:2x26A	0.102	0.062	5.509	308	0.079	0.042	2x26A.pdb.gz
13	PDB:4v8mBN	0.148	0.123	6.795	215	0.024	0.019	4v8mBN.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
14	PDB:8ap7N	0.131	0.151	8.380	139	0.073	0.086	8ap7N.pdb.gz	An ancestral interaction module promotes oligomerization in divergent mitochondrial ATP synthases.
15	PDB:6hivDD	0.123	0.042	9.638	791	0.085	0.018	6hivDD.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
16	PDB:7myjC	0.144	0.060	9.638	465	0.067	0.024	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P38936	2.67e-118	332	164	1.000	1.000	CDN1A_HUMAN Cyclin-dependent kinase inhibitor 1 OS=Homo sapiens OX=9606 GN=CDKN1A PE=1 SV=3
2	P39689	1.34e-81	239	159	0.768	0.792	CDN1A_MOUSE Cyclin-dependent kinase inhibitor 1 OS=Mus musculus OX=10090 GN=Cdkn1a PE=1 SV=4
3	Q564P6	1.34e-81	239	159	0.768	0.792	Q564P6_MOUSE Cyclin-dependent kinase inhibitor 1A variant 1 OS=Mus musculus OX=10090 GN=Cdkn1a PE=2 SV=1
4	Q64315	3.97e-80	236	164	0.756	0.756	Q64315_RAT Cyclin-dependent kinase inhibitor 1A OS=Rattus norvegicus OX=10116 GN=Cdkn1a PE=2 SV=1
5	A0A8I5ZZ18	2.52e-67	204	169	0.671	0.651	A0A8I5ZZ18_RAT Cyclin-dependent kinase inhibitor 1A OS=Rattus norvegicus OX=10116 GN=Cdkn1a PE=3 SV=1
6	A5WWG2	2.68e-21	86.7	154	0.335	0.357	A5WWG2_DANRE Cyclin-dependent kinase inhibitor 1 OS=Danio rerio OX=7955 GN=cip1 PE=2 SV=1
7	O43806	3.69e-14	68.2	158	0.220	0.228	O43806_HUMAN p27 kip1 protein (Fragment) OS=Homo sapiens OX=9606 GN=p27 kip1 PE=1 SV=1
8	Q96TE0	5.17e-14	68.6	198	0.220	0.182	Q96TE0_HUMAN Cdk inhibitor p27KIP1 OS=Homo sapiens OX=9606 PE=1 SV=1
9	P46527	1.38e-13	67.4	198	0.183	0.152	CDN1B_HUMAN Cyclin-dependent kinase inhibitor 1B OS=Homo sapiens OX=9606 GN=CDKN1B PE=1 SV=1
10	Q6I9V6	1.38e-13	67.4	198	0.183	0.152	Q6I9V6_HUMAN CDKN1B protein OS=Homo sapiens OX=9606 GN=CDKN1B PE=2 SV=1
11	O08769	2.45e-13	66.6	197	0.226	0.188	O08769_RAT Cyclin dependent kinase inhibitor OS=Rattus norvegicus OX=10116 GN=Cdkn1b PE=1 SV=1
12	Q6IQT7	8.41e-13	65.5	212	0.299	0.231	Q6IQT7_DANRE Cyclin-dependent kinase inhibitor 1C OS=Danio rerio OX=7955 GN=cdkn1c PE=2 SV=1
13	P46414	1.47e-12	64.7	197	0.226	0.188	CDN1B_MOUSE Cyclin-dependent kinase inhibitor 1B OS=Mus musculus OX=10090 GN=Cdkn1b PE=1 SV=2
14	Q91603	1.44e-11	62.0	210	0.293	0.229	Q91603_XENLA XICL OS=Xenopus laevis OX=8355 GN=Xicl PE=2 SV=1
15	P49918	2.31e-09	57.0	316	0.165	0.085	CDN1C_HUMAN Cyclin-dependent kinase inhibitor 1C OS=Homo sapiens OX=9606 GN=CDKN1C PE=1 SV=1
16	Q2WFZ6	5.22e-09	51.2	26	0.140	0.885	Q2WFZ6_RAT Cyclin-dependent kinase inhibitor 1A (Fragment) OS=Rattus norvegicus OX=10116 GN=Cdkn1a PE=4 SV=1
17	P49919	1.26e-08	55.1	348	0.244	0.115	CDN1C_MOUSE Cyclin-dependent kinase inhibitor 1C OS=Mus musculus OX=10090 GN=Cdkn1c PE=1 SV=2
18	Q69DC1	2.02e-08	54.3	355	0.244	0.113	Q69DC1_RAT Cyclin-dependent kinase inhibitor 1C OS=Rattus norvegicus OX=10116 GN=Cdkn1c PE=3 SV=1
19	Q69DC0	2.25e-08	54.3	343	0.244	0.117	Q69DC0_RAT CDKI protein OS=Rattus norvegicus OX=10116 GN=Cdkn1c PE=2 SV=1
20	Q22198	6.35e-04	41.2	258	0.122	0.078	Q22198_CAEEL Cyclin-dependent kinase inhibitor domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cki-2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02234 CDI	1e-14	65.7	Cyclin-dependent kinase inhibitor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384849

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000227507	0.999	G1/S-specific cyclin-D1
2	9606.ENSP00000257904	0.999	Cyclin-dependent kinase 4
3	9606.ENSP00000262643	0.999	G1/S-specific cyclin-E1
4	9606.ENSP00000265734	0.999	Cyclin-dependent kinase 6
5	9606.ENSP00000266970	0.999	Cyclin-dependent kinase 2
6	9606.ENSP00000269305	0.999	Cellular tumor antigen p53
7	9606.ENSP00000274026	0.999	Cyclin-A2
8	9606.ENSP00000368458	0.999	Proliferating cell nuclear antigen
9	9606.ENSP00000378699	0.999	Cyclin-dependent kinase 1
10	9606.ENSP00000256442	0.998	G2/mitotic-specific cyclin-B1
11	9606.ENSP00000360025	0.997	Growth arrest and DNA damage-inducible protein GADD45 alpha
12	9606.ENSP00000261254	0.996	G1/S-specific cyclin-D2
13	9606.ENSP00000362082	0.996	G1/S-specific cyclin-D3
14	9606.ENSP00000429089	0.996	G1/S-specific cyclin-E2
15	9606.ENSP00000255465	0.995	Cyclin-A1
16	9606.ENSP00000264657	0.995	Signal transducer and activator of transcription 3
17	9606.ENSP00000274255	0.994	S-phase kinase-associated protein 2
18	9606.ENSP00000311032	0.994	Caspase-3
19	9606.ENSP00000263253	0.993	Histone acetyltransferase p300
20	9606.ENSP00000451828	0.993	RAC-alpha serine/threonine-protein kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	0.998	protein-containing complex binding
GO:0005515	0.998	protein binding
GO:0004861	0.983	cyclin-dependent protein serine/threonine kinase inhibitor activity
GO:0019899	0.481	enzyme binding
GO:0003824	0.350	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0010212	0.990	response to ionizing radiation
GO:0031323	0.989	regulation of cellular metabolic process
GO:0051716	0.988	cellular response to stimulus
GO:0048522	0.985	positive regulation of cellular process
GO:0048523	0.981	negative regulation of cellular process
GO:0051172	0.966	negative regulation of nitrogen compound metabolic process
GO:1901987	0.959	regulation of cell cycle phase transition
GO:0031324	0.957	negative regulation of cellular metabolic process
GO:0010605	0.956	negative regulation of macromolecule metabolic process
GO:0006950	0.948	response to stress
GO:1901990	0.946	regulation of mitotic cell cycle phase transition
GO:0033554	0.938	cellular response to stress
GO:1901988	0.938	negative regulation of cell cycle phase transition
GO:0071900	0.937	regulation of protein serine/threonine kinase activity
GO:0051173	0.930	positive regulation of nitrogen compound metabolic process
GO:0000278	0.929	mitotic cell cycle
GO:1901991	0.924	negative regulation of mitotic cell cycle phase transition
GO:0000079	0.921	regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0008152	0.913	metabolic process
GO:1903047	0.901	mitotic cell cycle process
GO:0006974	0.900	cellular response to DNA damage stimulus
GO:0007165	0.898	signal transduction
GO:0031570	0.892	DNA integrity checkpoint signaling
GO:0031325	0.890	positive regulation of cellular metabolic process
GO:0000077	0.880	DNA damage checkpoint signaling
GO:0010604	0.877	positive regulation of macromolecule metabolic process
GO:0019219	0.874	regulation of nucleobase-containing compound metabolic process
GO:0007093	0.870	mitotic cell cycle checkpoint signaling
GO:0071478	0.858	cellular response to radiation
GO:0071479	0.807	cellular response to ionizing radiation
GO:0009889	0.774	regulation of biosynthetic process
GO:0072331	0.754	signal transduction by p53 class mediator
GO:0044773	0.742	mitotic DNA damage checkpoint signaling
GO:0010556	0.733	regulation of macromolecule biosynthetic process
GO:0031326	0.733	regulation of cellular biosynthetic process
GO:0030330	0.733	DNA damage response, signal transduction by p53 class mediator
GO:0045936	0.716	negative regulation of phosphate metabolic process
GO:0044237	0.704	cellular metabolic process
GO:1902806	0.703	regulation of cell cycle G1/S phase transition
GO:0071704	0.692	organic substance metabolic process
GO:1902749	0.674	regulation of cell cycle G2/M phase transition
GO:0006807	0.660	nitrogen compound metabolic process
GO:1902807	0.643	negative regulation of cell cycle G1/S phase transition
GO:0031400	0.642	negative regulation of protein modification process
GO:0048856	0.639	anatomical structure development
GO:0044238	0.615	primary metabolic process
GO:0010941	0.610	regulation of cell death
GO:0044092	0.607	negative regulation of molecular function
GO:0032501	0.605	multicellular organismal process
GO:0043086	0.592	negative regulation of catalytic activity
GO:0010468	0.592	regulation of gene expression
GO:0051348	0.535	negative regulation of transferase activity
GO:0006469	0.534	negative regulation of protein kinase activity
GO:0043170	0.528	macromolecule metabolic process
GO:0010389	0.520	regulation of G2/M transition of mitotic cell cycle
GO:0042127	0.509	regulation of cell population proliferation
GO:0042221	0.494	response to chemical
GO:0010972	0.479	negative regulation of G2/M transition of mitotic cell cycle
GO:2000045	0.451	regulation of G1/S transition of mitotic cell cycle
GO:0044818	0.434	mitotic G2/M transition checkpoint
GO:0043067	0.416	regulation of programmed cell death
GO:0048583	0.408	regulation of response to stimulus
GO:2000134	0.403	negative regulation of G1/S transition of mitotic cell cycle
GO:0042981	0.390	regulation of apoptotic process
GO:0051252	0.383	regulation of RNA metabolic process
GO:0008285	0.367	negative regulation of cell population proliferation
GO:0008219	0.362	cell death
GO:0045935	0.352	positive regulation of nucleobase-containing compound metabolic process
GO:0007275	0.347	multicellular organism development
GO:0051247	0.339	positive regulation of protein metabolic process
GO:0006355	0.333	regulation of DNA-templated transcription
GO:0009966	0.325	regulation of signal transduction
GO:0009891	0.325	positive regulation of biosynthetic process
GO:0031328	0.300	positive regulation of cellular biosynthetic process
GO:0045934	0.300	negative regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.998	protein-containing complex
GO:0005829	0.996	cytosol
GO:1902494	0.973	catalytic complex
GO:0043232	0.927	intracellular non-membrane-bounded organelle
GO:1990234	0.925	transferase complex
GO:0016604	0.829	nuclear body
GO:0061695	0.574	transferase complex, transferring phosphorus-containing groups
GO:1902911	0.517	protein kinase complex
GO:1902554	0.510	serine/threonine protein kinase complex
GO:0140513	0.481	nuclear protein-containing complex
GO:0000307	0.435	cyclin-dependent protein kinase holoenzyme complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]