StarFunc result for job id P39059

User Input

>input (1388 residues)
MAPRRNNGQCWCLLMLLSVSTPLPAVTQTRGATETASQGHLDLTQLIGVPLPSSVSFVTG
YGGFPAYSFGPGANVGRPARTLIPSTFFRDFAISVVVKPSSTRGGVLFAITDAFQKVIYL
GLRLSGVEDGHQRIILYYTEPGSHVSQEAAAFSVPVMTHRWNRFAMIVQGEEVTLLVNCE
EHSRIPFQRSSQALAFESSAGIFMGNAGATGLERFTGSLQQLTVHPDPRTPEELCDPEES
SASGETSGLQEADGVAEILEAVTYTQASPKEAKVEPINTPPTPSSPFEDMELSGEPVPEG
TLETTNMSIIQHSSPKQGSGEILNDTLEGVHSVDGDPITDSGSGAGAFLDIAEEKNLAAT
AAGLAEVPISTAGEAEASSVPTGGPTLSMSTENPEEGVTPGPDNEERLAATAAGEAEALA
SMPGEVEASGVAPGELDLSMSAQSLGEEATVGPSSEDSLTTAAAATEVSLSTFEDEEASG
VPTDGLAPLTATMAPERAVTSGPGDEEDLAAATTEEPLITAGGEESGSPPPDGPPLPLPT
VAPERWITPAQREHVGMKGQAGPKGEKGDAGEELPGPPEPSGPVGPTAGAEAEGSGLGWG
SDVGSGSGDLVGSEQLLRGPPGPPGPPGLPGIPGKPGTDVFMGPPGSPGEDGPAGEPGPP
GPEGQPGVDGATGLPGMKGEKGARGPNGSVGEKGDPGNRGLPGPPGKKGQAGPPGVMGPP
GPPGPPGPPGPGCTMGLGFEDTEGSGSTQLLNEPKLSRPTAAIGLKGEKGDRGPKGERGM
DGASIVGPPGPRGPPGHIKVLSNSLINITHGFMNFSDIPELVGPPGPDGLPGLPGFPGPR
GPKGDTGLPGFPGLKGEQGEKGEPGAILTEDIPLERLMGKKGEPGMHGAPGPMGPKGPPG
HKGEFGLPGRPGRPGLNGLKGTKGDPGVIMQGPPGLPGPPGPPGPPGAVINIKGAIFPIP
VRPHCKMPVDTAHPGSPELITFHGVKGEKGSWGLPGSKGEKGDQGAQGPPGPPLDLAYLR
HFLNNLKGENGDKGFKGEKGEKGDINGSFLMSGPPGLPGNPGPAGQKGETVVGPQGPPGA
PGLPGPPGFGRPGDPGPPGPPGPPGPPAILGAAVALPGPPGPPGQPGLPGSRNLVTAFSN
MDDMLQKAHLVIEGTFIYLRDSTEFFIRVRDGWKKLQLGELIPIPADSPPPPALSSNPHQ
LLPPPNPISSANYEKPALHLAALNMPFSGDIRADFQCFKQARAAGLLSTYRAFLSSHLQD
LSTIVRKAERYSLPIVNLKGQVLFNNWDSIFSGHGGQFNMHIPIYSFDGRDIMTDPSWPQ
KVIWHGSSPHGVRLVDNYCEAWRTADTAVTGLASPLSTGKILDQKAYSCANRLIVLCIEN
SFMTDARK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O35206	0.223	0.226	0.000	1367	0.721	0.732	O35206.pdb.gz	COFA1_MOUSE Collagen alpha-1(XV) chain OS=Mus musculus OX=10090 GN=Col15a1 PE=1 SV=2
2	AFDB:P39059	1.000	1.000	0.000	1388	1.000	1.000	P39059.pdb.gz	COFA1_HUMAN Collagen alpha-1(XV) chain OS=Homo sapiens OX=9606 GN=COL15A1 PE=1 SV=2
3	AFDB:P39061	0.198	0.162	2.126E-66	1774	0.402	0.315	P39061.pdb.gz	COIA1_MOUSE Collagen alpha-1(XVIII) chain OS=Mus musculus OX=10090 GN=Col18a1 PE=1 SV=4
4	AFDB:B0S8G4	0.147	0.139	4.718E-65	1645	0.383	0.323	B0S8G4.pdb.gz
5	AFDB:Q8BLX7	0.133	0.118	3.345E-18	1580	0.262	0.230	Q8BLX7.pdb.gz	COGA1_MOUSE Collagen alpha-1(XVI) chain OS=Mus musculus OX=10090 GN=Col16a1 PE=1 SV=2
6	AFDB:Q9JI03	0.130	0.101	3.420E-17	1840	0.277	0.209	Q9JI03.pdb.gz	CO5A1_RAT Collagen alpha-1(V) chain OS=Rattus norvegicus OX=10116 GN=Col5a1 PE=1 SV=1
7	AFDB:Q0VF58	0.123	0.149	8.763E-17	1136	0.223	0.272	Q0VF58.pdb.gz	COJA1_MOUSE Collagen alpha-1(XIX) chain OS=Mus musculus OX=10090 GN=Col19a1 PE=2 SV=2
8	AFDB:I3ISS1	0.131	0.102	1.093E-16	1803	0.278	0.214	I3ISS1.pdb.gz
9	AFDB:Q07092	0.128	0.111	1.442E-16	1604	0.251	0.218	Q07092.pdb.gz	COGA1_HUMAN Collagen alpha-1(XVI) chain OS=Homo sapiens OX=9606 GN=COL16A1 PE=1 SV=2
10	AFDB:P12107	0.132	0.103	3.308E-16	1806	0.259	0.199	P12107.pdb.gz	COBA1_HUMAN Collagen alpha-1(XI) chain OS=Homo sapiens OX=9606 GN=COL11A1 PE=1 SV=4
11	PDB:7zl1A	0.089	0.494	3.807E-7	215	0.019	0.126	7zl1A.pdb.gz
12	PDB:7ufgB	0.107	0.124	4.750E-7	1182	0.017	0.020	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
13	PDB:4pbpB	0.105	0.599	1.793E-6	210	0.021	0.138	4pbpB.pdb.gz	Crystal structures for short-chain pentraxin from zebrafish demonstrate a cyclic trimer with new recognition and effector faces.
14	PDB:7qfqA	0.077	0.082	2.003E-6	1291	0.015	0.016	7qfqA.pdb.gz
15	PDB:3vv1A	0.079	0.537	2.500E-6	141	0.017	0.170	3vv1A.pdb.gz	Structural basis of preferential binding of fucose-containing saccharide by the Caenorhabditis elegans galectin LEC-6
16	PDB:3v0aB	0.101	0.120	5.133E-6	1150	0.014	0.017	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
17	PDB:7ufgA	0.104	0.124	7.562E-6	1151	0.015	0.018	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
18	PDB:5n0cA	0.104	0.111	1.177E-5	1293	0.017	0.018	5n0cA.pdb.gz	The structure of the tetanus toxin reveals pH-mediated domain dynamics.
19	PDB:8a7eC	0.087	0.080	1.390E-5	1524	0.014	0.013	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
20	PDB:2a3wA	0.086	0.508	4.698E-5	204	0.014	0.093	2a3wA.pdb.gz	Ligand-assisted Aggregation of Proteins: DIMERIZATION OF SERUM AMYLOID P COMPONENT BY BIVALENT LIGANDS.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1SSE8	0.0	1706	1359	0.803	0.820	F1SSE8_PIG Collagen type XV alpha 1 chain OS=Sus scrofa OX=9823 GN=COL15A1 PE=1 SV=4
2	O35206	0.0	1533	1367	0.731	0.743	COFA1_MOUSE Collagen alpha-1(XV) chain OS=Mus musculus OX=10090 GN=Col15a1 PE=1 SV=2
3	P39059	0.0	2714	1388	1.000	1.000	COFA1_HUMAN Collagen alpha-1(XV) chain OS=Homo sapiens OX=9606 GN=COL15A1 PE=1 SV=2
4	E1JI50	1.67e-78	279	787	0.184	0.324	E1JI50_DROME Multiplexin, isoform F OS=Drosophila melanogaster OX=7227 GN=Mp PE=4 SV=1
5	E1JI49	2.03e-78	279	813	0.183	0.312	E1JI49_DROME Multiplexin, isoform H OS=Drosophila melanogaster OX=7227 GN=Mp PE=4 SV=1
6	Q86BH1	2.28e-78	278	778	0.183	0.326	Q86BH1_DROME Multiplexin, isoform E OS=Drosophila melanogaster OX=7227 GN=Mp PE=4 SV=1
7	Q8MT89	1.92e-77	276	792	0.184	0.322	Q8MT89_DROME GH14382p OS=Drosophila melanogaster OX=7227 GN=Mp PE=2 SV=1
8	E1JIE1	5.94e-77	279	1008	0.182	0.251	E1JIE1_DROME Multiplexin, isoform B OS=Drosophila melanogaster OX=7227 GN=Mp PE=4 SV=1
9	E1JIE0	1.27e-76	278	1017	0.184	0.251	E1JIE0_DROME Multiplexin, isoform M OS=Drosophila melanogaster OX=7227 GN=Mp PE=4 SV=1
10	X2JCL0	1.29e-76	277	973	0.181	0.258	X2JCL0_DROME Multiplexin, isoform U OS=Drosophila melanogaster OX=7227 GN=Mp PE=4 SV=1
11	E1JIE3	2.42e-76	277	1013	0.180	0.247	E1JIE3_DROME Multiplexin, isoform O OS=Drosophila melanogaster OX=7227 GN=Mp PE=4 SV=2
12	X2JC42	5.39e-76	276	1022	0.182	0.248	X2JC42_DROME Multiplexin, isoform T OS=Drosophila melanogaster OX=7227 GN=Mp PE=4 SV=1
13	E1JID9	2.02e-75	274	1023	0.182	0.246	E1JID9_DROME Multiplexin, isoform G OS=Drosophila melanogaster OX=7227 GN=Mp PE=4 SV=1
14	X2JGC3	7.92e-74	265	804	0.184	0.318	X2JGC3_DROME Multiplexin, isoform S OS=Drosophila melanogaster OX=7227 GN=Mp PE=4 SV=1
15	E1JIE2	1.11e-73	268	971	0.161	0.230	E1JIE2_DROME Multiplexin, isoform L OS=Drosophila melanogaster OX=7227 GN=Mp PE=4 SV=1
16	D3GN36	9.55e-73	268	1169	0.103	0.122	D3GN36_DANRE Collagen alpha-1(XV) chain precursor OS=Danio rerio OX=7955 GN=wu:fb50f05 PE=1 SV=2
17	E1JI52	4.86e-72	254	579	0.142	0.340	E1JI52_DROME Multiplexin, isoform J OS=Drosophila melanogaster OX=7227 GN=Mp PE=4 SV=1
18	M9ND55	8.29e-72	264	1039	0.183	0.244	M9ND55_DROME Multiplexin, isoform R OS=Drosophila melanogaster OX=7227 GN=Mp PE=4 SV=1
19	Q9WUW5	1.27e-65	221	171	0.076	0.614	Q9WUW5_RAT Collagen type XVIII, alpha (I) chain (Fragment) OS=Rattus norvegicus OX=10116 GN=Col18a1 PE=2 SV=1
20	P39061	4.59e-65	246	1774	0.099	0.077	COIA1_MOUSE Collagen alpha-1(XVIII) chain OS=Mus musculus OX=10090 GN=Col18a1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01391 Collagen	2.6e-45	163.3	Collagen triple helix repeat (20 copies)
2	PF20010 Collagen_trimer	1.6e-19	80.9	Collagen trimerization domain
3	PF06482 Endostatin	3.7e-77	269.2	Collagenase NC10 and Endostatin
4	PF13385 Laminin_G_3	0.0049	28.5	Concanavalin A-like lectin/glucanases superfamily

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364140

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379823	0.925	Collagen alpha-3(IV) chain
2	9606.ENSP00000299855	0.923	Stromelysin-1
3	9606.ENSP00000379866	0.922	Collagen alpha-4(IV) chain
4	9606.ENSP00000401749	0.922	Prolyl 4-hydroxylase subunit alpha-3
5	9606.ENSP00000384999	0.921	Prolyl 4-hydroxylase subunit alpha-2
6	9606.ENSP00000361405	0.916	Matrix metalloproteinase-9
7	9606.ENSP00000260302	0.914	Collagenase 3
8	9606.ENSP00000263556	0.914	Prolyl 4-hydroxylase subunit alpha-1
9	9606.ENSP00000260227	0.912	Matrilysin
10	9606.ENSP00000260228	0.904	Matrix metalloproteinase-20
11	9606.ENSP00000345672	0.904	Cathepsin B
12	9606.ENSP00000445052	0.903	Cathepsin L2
13	9606.ENSP00000345344	0.902	Cathepsin L1
14	9606.ENSP00000357981	0.902	Cathepsin S
15	9606.ENSP00000359864	0.797	Glypican-4
16	9606.ENSP00000261037	0.781	Collagen alpha-1(VIII) chain
17	9606.ENSP00000196061	0.743	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1
18	9606.ENSP00000282903	0.723	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2
19	9606.ENSP00000364979	0.709	Collagen alpha-1(IV) chain
20	9606.ENSP00000353654	0.707	Collagen alpha-2(IV) chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.417	structural molecule activity
GO:0005201	0.330	extracellular matrix structural constituent

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.976	cellular process
GO:0050896	0.948	response to stimulus
GO:0032502	0.902	developmental process
GO:0048856	0.880	anatomical structure development
GO:0009628	0.804	response to abiotic stimulus
GO:0065007	0.799	biological regulation
GO:0050789	0.794	regulation of biological process
GO:0032501	0.710	multicellular organismal process
GO:0042221	0.665	response to chemical
GO:0010033	0.644	response to organic substance
GO:0050794	0.593	regulation of cellular process
GO:0007275	0.522	multicellular organism development
GO:1901700	0.494	response to oxygen-containing compound
GO:0071840	0.447	cellular component organization or biogenesis
GO:0016043	0.434	cellular component organization
GO:0030198	0.316	extracellular matrix organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0062023	1.000	collagen-containing extracellular matrix
GO:0005615	0.999	extracellular space
GO:0012505	0.998	endomembrane system
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0070013	0.998	intracellular organelle lumen
GO:0005737	0.997	cytoplasm
GO:0032991	0.989	protein-containing complex
GO:0005604	0.986	basement membrane
GO:0005788	0.957	endoplasmic reticulum lumen
GO:0005581	0.905	collagen trimer
GO:0065010	0.898	extracellular membrane-bounded organelle
GO:0031982	0.882	vesicle
GO:1903561	0.861	extracellular vesicle
GO:0070062	0.849	extracellular exosome
GO:0098651	0.525	basement membrane collagen trimer
GO:0005582	0.384	collagen type XV trimer

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]