StarFunc result for job id P39060

User Input

>input (1754 residues)
MAPYPCGCHILLLLFCCLAAARANLLNLNWLWFNNEDTSHAATTIPEPQGPLPVQPTADT
TTHVTPRNGSTEPATAPGSPEPPSELLEDGQDTPTSAESPDAPEENIAGVGAEILNVAKG
IRSFVQLWNDTVPTESLARAETLVLETPVGPLALAGPSSTPQENGTTLWPSRGIPSSPGA
HTTEAGTLPAPTPSPPSLGRPWAPLTGPSVPPPSSGRASLSSLLGGAPPWGSLQDPDSQG
LSPAAAAPSQQLQRPDVRLRTPLLHPLVMGSLGKHAAPSAFSSGLPGALSQVAVTTLTRD
SGAWVSHVANSVGPGLANNSALLGADPEAPAGRCLPLPPSLPVCGHLGISRFWLPNHLHH
ESGEQVRAGARAWGGLLQTHCHPFLAWFFCLLLVPPCGSVPPPAPPPCCQFCEALQDACW
SRLGGGRLPVACASLPTQEDGYCVLIGPAAERISEEVGLLQLLGDPPPQQVTQTDDPDVG
LAYVFGPDANSGQVARYHFPSLFFRDFSLLFHIRPATEGPGVLFAITDSAQAMVLLGVKL
SGVQDGHQDISLLYTEPGAGQTHTAASFRLPAFVGQWTHLALSVAGGFVALYVDCEEFQR
MPLARSSRGLELEPGAGLFVAQAGGADPDKFQGVIAELKVRRDPQVSPMHCLDEEGDDSD
GASGDSGSGLGDARELLREETGAALKPRLPAPPPVTTPPLAGGSSTEDSRSEEVEEQTTV
ASLGAQTLPGSDSVSTWDGSVRTPGGRVKEGGLKGQKGEPGVPGPPGRAGPPGSPCLPGP
PGLPCPVSPLGPAGPALQTVPGPQGPPGPPGRDGTPGRDGEPGDPGEDGKPGDTGPQGFP
GTPGDVGPKGDKGDPGVGERGPPGPQGPPGPPGPSFRHDKLTFIDMEGSGFGGDLEALRG
PRGFPGPPGPPGVPGLPGEPGRFGVNSSDVPGPAGLPGVPGREGPPGFPGLPGPPGPPGR
EGPPGRTGQKGSLGEAGAPGHKGSKGAPGPAGARGESGLAGAPGPAGPPGPPGPPGPPGP
GLPAGFDDMEGSGGPFWSTARSADGPQGPPGLPGLKGDPGVPGLPGAKGEVGADGVPGFP
GLPGREGIAGPQGPKGDRGSRGEKGDPGKDGVGQPGLPGPPGPPGPVVYVSEQDGSVLSV
PGPEGRPGFAGFPGPAGPKGNLGSKGERGSPGPKGEKGEPGSIFSPDGGALGPAQKGAKG
EPGFRGPPGPYGRPGYKGEIGFPGRPGRPGMNGLKGEKGEPGDASLGFGMRGMPGPPGPP
GPPGPPGTPVYDSNVFAESSRPGPPGLPGNQGPPGPKGAKGEVGPPGPPGQFPFDFLQLE
AEMKGEKGDRGDAGQKGERGEPGGGGFFGSSLPGPPGPPGPPGPRGYPGIPGPKGESIRG
QPGPPGPQGPPGIGYEGRQGPPGPPGPPGPPSFPGPHRQTISVPGPPGPPGPPGPPGTMG
ASSGVRLWATRQAMLGQVHEVPEGWLIFVAEQEELYVRVQNGFRKVQLEARTPLPRGTDN
EVAALQPPVVQLHDSNPYPRREHPHPTARPWRADDILASPPRLPEPQPYPGAPHHSSYVH
LRPARPTSPPAHSHRDFQPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAF
LSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVL
RHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAY
IVLCIENSFMTASK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P39060	1.000	1.000	0.000	1754	1.000	1.000	P39060.pdb.gz	COIA1_HUMAN Collagen alpha-1(XVIII) chain OS=Homo sapiens OX=9606 GN=COL18A1 PE=1 SV=5
2	AFDB:P39061	0.287	0.285	0.000	1774	0.713	0.705	P39061.pdb.gz	COIA1_MOUSE Collagen alpha-1(XVIII) chain OS=Mus musculus OX=10090 GN=Col18a1 PE=1 SV=4
3	AFDB:B0S8G4	0.216	0.227	6.209E-103	1645	0.433	0.462	B0S8G4.pdb.gz
4	AFDB:P39059	0.161	0.195	2.309E-63	1388	0.303	0.383	P39059.pdb.gz	COFA1_HUMAN Collagen alpha-1(XV) chain OS=Homo sapiens OX=9606 GN=COL15A1 PE=1 SV=2
5	AFDB:O35206	0.125	0.155	1.023E-62	1367	0.298	0.382	O35206.pdb.gz	COFA1_MOUSE Collagen alpha-1(XV) chain OS=Mus musculus OX=10090 GN=Col15a1 PE=1 SV=2
6	AFDB:G3MXK9	0.100	0.135	5.019E-14	1257	0.187	0.261	G3MXK9.pdb.gz	G3MXK9_BOVIN Collagen type XVI alpha 1 chain OS=Bos taurus OX=9913 GN=COL16A1 PE=4 SV=2
7	AFDB:Q0VF58	0.097	0.142	3.455E-13	1136	0.190	0.294	Q0VF58.pdb.gz	COJA1_MOUSE Collagen alpha-1(XIX) chain OS=Mus musculus OX=10090 GN=Col19a1 PE=2 SV=2
8	AFDB:F6T0B3	0.108	0.114	1.448E-12	1650	0.230	0.244	F6T0B3.pdb.gz	F6T0B3_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=2
9	AFDB:Q8BLX7	0.101	0.111	3.697E-12	1580	0.238	0.265	Q8BLX7.pdb.gz	COGA1_MOUSE Collagen alpha-1(XVI) chain OS=Mus musculus OX=10090 GN=Col16a1 PE=1 SV=2
10	AFDB:A0MSJ1	0.106	0.111	5.437E-12	1658	0.229	0.242	A0MSJ1.pdb.gz	CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio OX=7955 GN=col27a1b PE=2 SV=1
11	PDB:7ufgB	0.083	0.121	1.910E-7	1182	0.017	0.025	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
12	PDB:4pbpB	0.080	0.536	1.315E-6	210	0.021	0.176	4pbpB.pdb.gz	Crystal structures for short-chain pentraxin from zebrafish demonstrate a cyclic trimer with new recognition and effector faces.
13	PDB:7zl1A	0.070	0.488	1.732E-6	215	0.015	0.121	7zl1A.pdb.gz
14	PDB:7ufgA	0.084	0.125	3.176E-6	1151	0.017	0.025	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
15	PDB:8a7eC	0.080	0.091	3.355E-6	1524	0.017	0.020	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
16	PDB:7qfqA	0.074	0.098	3.546E-6	1291	0.015	0.020	7qfqA.pdb.gz
17	PDB:2a3wA	0.070	0.516	8.105E-6	204	0.014	0.123	2a3wA.pdb.gz	Ligand-assisted Aggregation of Proteins: DIMERIZATION OF SERUM AMYLOID P COMPONENT BY BIVALENT LIGANDS.
18	PDB:3v0aB	0.090	0.134	1.068E-5	1150	0.015	0.023	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
19	PDB:1b09A	0.077	0.505	1.192E-5	206	0.016	0.136	1b09A.pdb.gz	The physiological structure of human C-reactive protein and its complex with phosphocholine.
20	PDB:3vv1A	0.063	0.569	4.997E-5	141	0.013	0.156	3vv1A.pdb.gz	Structural basis of preferential binding of fucose-containing saccharide by the Caenorhabditis elegans galectin LEC-6

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZV54	0.0	1384	1320	0.574	0.763	A0A8I5ZV54_RAT Collagen type XVIII alpha 1 chain OS=Rattus norvegicus OX=10116 GN=Col18a1 PE=1 SV=1
2	A0A8I6GLR1	0.0	1758	1785	0.715	0.703	A0A8I6GLR1_RAT Collagen type XVIII alpha 1 chain OS=Rattus norvegicus OX=10116 GN=Col18a1 PE=1 SV=1
3	F1LR02	0.0	1369	1311	0.570	0.763	F1LR02_RAT Collagen type XVIII alpha 1 chain OS=Rattus norvegicus OX=10116 GN=Col18a1 PE=4 SV=2
4	P39060	0.0	3366	1754	1.000	1.000	COIA1_HUMAN Collagen alpha-1(XVIII) chain OS=Homo sapiens OX=9606 GN=COL18A1 PE=1 SV=5
5	P39061	0.0	1771	1774	0.706	0.698	COIA1_MOUSE Collagen alpha-1(XVIII) chain OS=Mus musculus OX=10090 GN=Col18a1 PE=1 SV=4
6	Q9WUW5	4.90e-99	317	171	0.083	0.854	Q9WUW5_RAT Collagen type XVIII, alpha (I) chain (Fragment) OS=Rattus norvegicus OX=10116 GN=Col18a1 PE=2 SV=1
7	D3GN36	3.25e-69	258	1169	0.196	0.293	D3GN36_DANRE Collagen alpha-1(XV) chain precursor OS=Danio rerio OX=7955 GN=wu:fb50f05 PE=1 SV=2
8	A0MSJ1	7.12e-65	246	1658	0.179	0.189	CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio OX=7955 GN=col27a1b PE=2 SV=1
9	Q8MT89	7.43e-62	230	792	0.125	0.278	Q8MT89_DROME GH14382p OS=Drosophila melanogaster OX=7227 GN=Mp PE=2 SV=1
10	X2JC42	3.88e-61	231	1022	0.125	0.214	X2JC42_DROME Multiplexin, isoform T OS=Drosophila melanogaster OX=7227 GN=Mp PE=4 SV=1
11	E1JI50	6.36e-61	227	787	0.125	0.280	E1JI50_DROME Multiplexin, isoform F OS=Drosophila melanogaster OX=7227 GN=Mp PE=4 SV=1
12	E1JIE0	1.67e-60	229	1017	0.125	0.215	E1JIE0_DROME Multiplexin, isoform M OS=Drosophila melanogaster OX=7227 GN=Mp PE=4 SV=1
13	F1SSE8	7.01e-60	229	1359	0.078	0.100	F1SSE8_PIG Collagen type XV alpha 1 chain OS=Sus scrofa OX=9823 GN=COL15A1 PE=1 SV=4
14	E1JIE3	2.55e-59	226	1013	0.125	0.217	E1JIE3_DROME Multiplexin, isoform O OS=Drosophila melanogaster OX=7227 GN=Mp PE=4 SV=2
15	Q86BH1	1.63e-58	220	778	0.124	0.279	Q86BH1_DROME Multiplexin, isoform E OS=Drosophila melanogaster OX=7227 GN=Mp PE=4 SV=1
16	E1JI49	2.14e-58	220	813	0.124	0.267	E1JI49_DROME Multiplexin, isoform H OS=Drosophila melanogaster OX=7227 GN=Mp PE=4 SV=1
17	E1JIE1	6.55e-58	221	1008	0.124	0.216	E1JIE1_DROME Multiplexin, isoform B OS=Drosophila melanogaster OX=7227 GN=Mp PE=4 SV=1
18	X2JCL0	6.66e-58	221	973	0.124	0.224	X2JCL0_DROME Multiplexin, isoform U OS=Drosophila melanogaster OX=7227 GN=Mp PE=4 SV=1
19	E1JID9	7.31e-58	221	1023	0.128	0.219	E1JID9_DROME Multiplexin, isoform G OS=Drosophila melanogaster OX=7227 GN=Mp PE=4 SV=1
20	P39059	2.23e-57	221	1388	0.058	0.073	COFA1_HUMAN Collagen alpha-1(XV) chain OS=Homo sapiens OX=9606 GN=COL15A1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01391 Collagen	1.4e-60	212.2	Collagen triple helix repeat (20 copies)
2	PF20010 Collagen_trimer	5.3e-16	69.7	Collagen trimerization domain
3	PF06121 DUF959	2.4e-46	169.9	Domain of Unknown Function (DUF959)
4	PF06482 Endostatin	5.5e-83	288.2	Collagenase NC10 and Endostatin
5	PF01392 Fz	5.2e-12	57.8	Fz domain
6	PF13385 Laminin_G_3	0.0072	27.9	Concanavalin A-like lectin/glucanases superfamily

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000053920

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000013860	0.895	Matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase)
2	9598.ENSPTRP00000022272	0.805	Uncharacterized protein
3	9598.ENSPTRP00000023334	0.793	Matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)
4	9598.ENSPTRP00000004110	0.762	Integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12)
5	9598.ENSPTRP00000008580	0.757	Uncharacterized protein
6	9598.ENSPTRP00000000536	0.729	Uncharacterized protein
7	9598.ENSPTRP00000007260	0.729	Matrix metallopeptidase 3 (Stromelysin 1, progelatinase)
8	9598.ENSPTRP00000038388	0.729	Glypican 4
9	9598.ENSPTRP00000027639	0.722	Uncharacterized protein
10	9598.ENSPTRP00000007254	0.716	Matrix metallopeptidase 7 (matrilysin, uterine)
11	9598.ENSPTRP00000007265	0.692	Matrix metallopeptidase 13 (collagenase 3)
12	9598.ENSPTRP00000007255	0.669	Matrix metallopeptidase 20
13	9598.ENSPTRP00000004548	0.658	Prolyl 4-hydroxylase, alpha polypeptide I
14	9598.ENSPTRP00000038972	0.658	Prolyl 4-hydroxylase, alpha polypeptide II
15	9598.ENSPTRP00000029905	0.652	Teneurin transmembrane protein 2
16	9598.ENSPTRP00000034241	0.651	Cathepsin B
17	9598.ENSPTRP00000006989	0.646	Uncharacterized protein
18	9598.ENSPTRP00000002145	0.645	Cathepsin K
19	9598.ENSPTRP00000022211	0.630	Uncharacterized protein
20	9598.ENSPTRP00000002144	0.622	Cathepsin S

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.965	biological regulation
GO:0032502	0.957	developmental process
GO:0048856	0.951	anatomical structure development
GO:0050794	0.949	regulation of cellular process
GO:0032501	0.941	multicellular organismal process
GO:0009653	0.915	anatomical structure morphogenesis
GO:0009987	0.800	cellular process
GO:0048513	0.798	animal organ development
GO:0042127	0.681	regulation of cell population proliferation
GO:0048519	0.667	negative regulation of biological process
GO:0048523	0.623	negative regulation of cellular process
GO:0050896	0.572	response to stimulus
GO:0048518	0.472	positive regulation of biological process
GO:0048522	0.436	positive regulation of cellular process
GO:0007275	0.435	multicellular organism development
GO:0050953	0.388	sensory perception of light stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0062023	0.999	collagen-containing extracellular matrix
GO:0005615	0.998	extracellular space
GO:0043227	0.997	membrane-bounded organelle
GO:0012505	0.996	endomembrane system
GO:0005737	0.995	cytoplasm
GO:0070013	0.995	intracellular organelle lumen
GO:0032991	0.992	protein-containing complex
GO:0043231	0.992	intracellular membrane-bounded organelle
GO:0005581	0.981	collagen trimer
GO:0031982	0.915	vesicle
GO:0005783	0.911	endoplasmic reticulum
GO:0043230	0.889	extracellular organelle
GO:1903561	0.880	extracellular vesicle
GO:0070062	0.870	extracellular exosome
GO:0005788	0.860	endoplasmic reticulum lumen
GO:0005604	0.416	basement membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]